KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL199CHelp
Entry
AGOS_AGL199C      CDS       T00167                                 

Definition
AGL199Cp
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AGOS_AGL199C
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AGOS_AGL199C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(324892..326571)
Genome map
AA seq 559 aa AA seqDB search
MPHPDARKSRSEVKTAPARSWSRSRSGQRPPSLPRVKSSQRLIRTISIEGRSHDGRAEEG
RAEDGDDGLLRLAFGSEKQQYIEVPYVKATLDASLPEEYLRQDVVNMTWNLQVPKWYRPG
TRVAPEEVKLVMITGTMTNAIFKVEHPRLPSLLLRVYGPNVESIIDRDYELQTLARLSRQ
NIGPSLYGCFMNGRFEQFLENATTLTKKDIRDWKTSQRIARRMKEFHCGVPLLDWEKTHY
TVLARIDKWLKKMGDSSWIQKKGNLQSTLFVQEWSQFLAVFERYRAWLKSVGELDQSLVF
CHNDAQYGNLLFTAPVVATDTSSVGTSTSTPVSGSLFPSESNISLDDIIRPSIHDQSQDS
KLVVIDFEYAGPNPAAYDLANHLSEWMADYHCAESYKTFEHKFPKKEEILNFIYSYTSHL
SASKQDPIDDKVRELYNSILRWRPCVSLHWAIWGLMQSGELDEPKDLAVAVEGAGPGGEK
YIITVDDCESINSIDSCLTDCSAVEEPTAKGADIHSFDYVSYTIEKMCLFYGDLLQLGIL
SKDDLPPGVQPKFLDSTFL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacccagacgcacgcaaatccagaagtgaggttaagacagcgccggcgcggtcg
tggtcgcgatcgaggagtgggcagcggccgccgtcgctgccgagggtgaaatcgtcgcaa
cgcctaatccgcacaatcagcattgagggccgcagccacgacgggcgggcggaggagggc
cgcgcagaggacggggacgacgggttgctgcgactggcgtttggatcggagaagcagcag
tacatcgaagtgccgtacgtgaaggcgacgctggacgcatcgctgccggaggagtatctg
cggcaggacgtggtgaacatgacatggaacctgcaggtgccgaagtggtaccggccgggg
acgcgggtggcgccggaggaggtgaagctagtgatgatcacggggaccatgaccaacgcc
atcttcaaggtggagcacccgcggctgccgagcctgctgcttcgagtgtacggaccgaac
gtggagtcgatcatagaccgggactacgagttgcagacgcttgcgcggctgtcgcgccaa
aacatcggcccgtcgctgtacggatgttttatgaatgggcgctttgagcaattcctggag
aacgccactacgcttacgaagaaggatatccgcgactggaagacatcgcagcggattgca
cggcggatgaaggagttccactgtggggtgccgctgctagactgggagaagacgcactac
acggtgctggcccgcatcgacaagtggctgaagaaaatgggagattcgagctggatccag
aagaagggcaatttacagagcacgctatttgtgcaggagtggtcgcagttcttggctgtt
ttcgagcggtaccgcgcgtggctgaaatcggttggggagctggatcagtctttagtgttt
tgccataacgacgctcagtacggtaacttgctatttaccgcacccgttgttgctacggac
accagctcagtaggcacgtcgactagtacgcccgtttctggatcgctattccctagtgaa
agcaacatctctctggatgacatcatccggccctccattcatgatcagtcacaagactca
aagctggtggtgattgactttgagtatgctggaccgaaccccgctgcatatgatcttgct
aaccacctatcggagtggatggcagactaccactgtgccgagtcctacaaaacctttgag
cacaagtttccgaagaaggaggagatcctcaacttcatttattcctacacttcccacctg
tcagctagtaagcaggaccctattgacgataaggtccgtgagctctacaacagtatattg
agatggaggccgtgtgtttcactgcattgggctatctgggggcttatgcagagtggcgag
ctagatgaacccaaagatcttgccgtagcagttgaaggagctggccccgggggcgagaag
tacattatcaccgtcgatgattgtgagagcattaacagcattgattcctgcctgaccgac
tgctcagccgtagaagagcctaccgcgaagggtgcagatatccactccttcgattatgtc
tcctacaccattgagaaaatgtgcttgttctacggagaccttctgcagttaggtatctta
tcaaaagatgacttaccgcctggagtacaaccgaagttcctagatagtacctttttgtag

DBGET integrated database retrieval system