KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL200WHelp
Entry
AGOS_AGL200W      CDS       T00167                                 

Definition
AGL200Wp
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_AGL200W
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_AGL200W
  Amino acid metabolism
   00310 Lysine degradation
    AGOS_AGL200W
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AGOS_AGL200W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:323344..324654
Genome map
AA seq 436 aa AA seqDB search
MLRSTLRVTSRAARPLAASMGRSSAVHAGAAAQAKLYSQIQMGAMHGPALQHLCGLRYAS
TSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVSGTVTKLNFK
PEDTVTVGEELAQIEEGAAPAGGQKPAAKEETSAPQEAAPASPAAKEEKPQAAKPAQAAP
AKEQPKQAAAQSSTVSAGASVSGFARTERRVKMNRMRMRIAERLKEAQNTAASLTTFNEV
DMSALLEMRKLYKDEILKTKGVKFGFMGLFAKAVALAQKEVPAVTGGIEGDQLVYRDYTD
ISIAVATPKGLVTPVVRNVESLSVLEIEQEISRLGQKAREGKITLEDMAGGNFTISNGGV
FGSLYGTPIINTPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRMLDGREGVTFL
KTIKELIEDPRKMLLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatctaccctacgtgtaacaagcagggcggccaggccattggcagcgtccatg
ggcagaagcagcgcagtacacgccggcgcggccgcgcaggccaagctatacagccagatc
cagatgggcgctatgcacggcccggcgttgcagcacctatgtggactgcggtacgcctcg
acgtcagtgcaggtgccacccatggccgagtcgttgacggagggttcgctcaaggagttc
acaaaacaggtgggcgagtatatcgaacaggacgagcttttggcgacgattgagacggat
aagatcgacatcgaggtcaacgcgcccgtgtccgggactgttacaaagttgaacttcaag
cccgaggacacagtgaccgttggcgaggagttggcacagattgaggagggcgccgctccg
gcaggtgggcagaagcctgccgcgaaagaggagacgtctgctccacaggaagccgctccg
gcgtcgcctgcggcaaaggaggagaagccacaggccgccaagcccgcgcaggccgcccct
gccaaggagcagccaaagcaagcggccgcgcagagctctaccgtgagcgccggcgcttct
gtcagcggttttgcgcgtactgagcgcagggtgaaaatgaaccgcatgaggatgagaatc
gctgagcggttaaaggaggcacagaacaccgcggcctctttgaccaccttcaacgaggtc
gacatgtccgcacttcttgagatgcgcaagctgtacaaggacgagatcttgaaaaccaag
ggcgtcaagttcggcttcatgggcctctttgcgaaggcagttgctctagcccagaaggag
gttcctgccgtcaccggtgggattgagggtgaccagcttgtctaccgcgactacaccgac
atttcgatcgctgttgcaacccccaagggtctcgtcacgcctgtggtgcggaatgtcgag
tctctctccgtcctagagattgagcaggagatttcaagattgggccagaaggcccgtgag
gggaagatcaccctagaggacatggccggtggcaactttaccatctccaacggtggtgtt
ttcggctccttatacggcactccaatcatcaacaccccacagactgctgttttgggtttg
cacggcgtaaaagagagaccagtcaccgtcaatggccagattgtttctagaccaatgatg
tacttggccttgacttatgaccacagaatgctagatggaagagagggtgtcacgttccta
aagacaatcaaggaattgattgaggacccaaggaagatgctccttgtttga

DBGET integrated database retrieval system