KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL212WHelp
Entry
AGOS_AGL212W      CDS       T00167                                 

Definition
AGL212Wp
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AGOS_AGL212W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AGOS_AGL212W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:298073..300784
Genome map
AA seq 903 aa AA seqDB search
MSNGLSLPKYANMPFRPPRMAKQGDKRRGGDSTAGGETAVVREGGLGKSVKDQEQTGDGL
KRPKRETKIFMVTYRKASNKKNKTWDGDGYGVLRSGEQLRVYNGDGKALGTYHWQADRAM
SDVVFRCGAGWECQLDYEIKDEREFSAALDTVKGALAPEKKSPCRTTVQPGPGAGGNNTP
TRVPLSKLFVGAKNTKFKPVMRSADAAIAAGSAASGRHCALFDKTQIDDPLVMNKAGDDE
VEVVVDPILSKKLRQHQRTGIKFMYDCVRGLARSEKDDDRTVMILEYDSDVKGCLLADEM
GLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWKKEFIKW
LPMNRIGILTLSSKNTPEKDKNDVRNFLRVQRTYQVLILGYEKLLNVFSELDQAKSKLDL
LICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTIINFINPGILGTFAH
FKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRTSSIIADYLPPRTDI
VVFCKPTQHQLDAFNQVLVGTRVDFQNMSFNSSLGLITLFKKICNSPSLVSSDSYFQSKV
NGGTPALRIAQSTTSGKLKVLMSLLHQIAHRSDNEKVVVISNYTQTLDIIGNLMSSASLS
YLRLDGSTPTKERDAIVNDFNRSQTIFGFLLSAKSGGVGLNLVGASRLILFDNDWNPSVD
LQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQRQLMKNNLSKKFLDDHCDDKSSDNVFE
QEDLKDLFSVQSGTLSNTHDLLCSCEGSGEEFEDTNTPPPSSENTEGGKAKMTGWMRALD
VKNIMDNSQKQQSALKATIMKKCLVGYRHINPRLMSDFGDHILERTLEEYPDSVTFAFVK
RNK
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacggtctcagtttgccgaagtacgccaatatgccattcaggcctccgcggatg
gcgaagcaaggggacaaaaggcggggcggagactccactgcgggcggcgagacggctgtg
gtgcgcgagggtggcttgggaaagagtgtgaaagaccaggagcagactggtgatggcttg
aagaggcctaaacgcgaaaccaagatattcatggtgacatacaggaaggccagcaacaag
aagaacaagacttgggatggagatggctacggggtgctgcggagtggcgagcaactgaga
gtttacaatggcgacggtaaagcgctgggcacgtaccattggcaggcggatcgtgccatg
tctgatgtggtatttcgatgcggggccgggtgggagtgccagctggactacgaaatcaag
gacgaacgtgaattttcagccgccctagatactgtcaagggtgcgctagcccccgaaaag
aagtcgccctgccgcacgaccgtgcagcctgggcctggagcaggcgggaacaacacgccg
acacgcgtacctctgtccaagctctttgtaggtgcgaaaaacaccaagttcaagccagtg
atgcgctctgcggatgccgctatcgcggcaggcagtgccgcttcgggccgccactgtgcg
ctattcgataagacacagatagatgacccactggtcatgaacaaagccggtgacgacgaa
gtcgaagttgtagtcgatcctattttgtcaaaaaagctacgccagcatcagagaacaggt
attaaattcatgtatgactgcgtccgggggctcgcaaggtccgagaaggacgatgataga
acagtgatgatcttggaatatgatagtgatgtcaagggttgtctgttggcggacgagatg
ggattagggaaaacatgcatgacgattgctctgatctggacgctactgaagcagcatccc
aggccatcgtctgttccatgctcgcaattgggggttgcgttgcagggtatttgccagaaa
gttctcgtggtatgcccggtgactctgattggcaactggaagaaggagttcatcaaatgg
ctgccgatgaatagaattggaatcttgacgctaagtagcaagaataccccagaaaaagac
aaaaatgacgttcgcaactttctgagggttcaacgtacctaccaggtgctaattcttggt
tatgaaaagctgctgaatgtcttttcagagttagaccaggctaaaagcaaattggactta
ttaatctgcgacgaaggtcacaggcttaagaattcatcatccaagatactgaagtgctta
accgatttggagattgaacggaaggtgattctgactggtacgcccatccagaacgatcta
aatgaattttatacaatcatcaattttatcaatcctggcattctgggcacctttgcacac
ttcaagcgagtatacataacacctattaccagggctagagatgtaaacaacaagcataat
gaccaaattgtctctctcggggaatccagatcacaagatttaattgaaataacaaaaaag
ttcatcctgagaagaaccagctccatcattgcagattacctaccaccgaggacagatatt
gtagtgttttgcaagccaacacagcatcagctagatgcttttaatcaagtgctggtggga
acccgcgtggactttcaaaatatgtcctttaattcctcacttgggttgataacactgttc
aaaaagatatgcaattctccaagcctagtaagttcggattcatactttcagagcaaggta
aatgggggcacccccgctttgagaatagcacaaagtacaacttctgggaaacttaaagtg
ctcatgtctctactgcaccaaatagcgcaccgcagtgataacgaaaaagttgtggttatc
tctaattacactcagacactcgatatcataggaaaccttatgtcgtctgcaagtttatcg
tatctacgtttggatggttcgacacccacgaaagagagggatgcaatagtgaacgatttc
aaccggagtcagactatttttggatttctattgagtgccaaatcaggtggcgttgggtta
aacctcgtcggtgcatcaagactaatcctattcgataacgactggaatccgtccgtcgac
ctgcaggcaatgtcgagaattcatagagatggtcagaaaaaaccttgctttatctaccgg
cttgtcactaccggatgtatcgacgagaagatattccagcggcagctgatgaagaataat
ctcagtaaaaagttcttggatgaccactgtgatgacaaatctagtgataacgtcttcgag
caggaagacttaaaagatttattcagcgtccaaagtggaacgctcagtaacacacacgac
ttactttgttcttgtgaaggttccggggaagaatttgaggacacaaatactcctccacct
tccagtgaaaacactgaaggtggaaaagccaagatgacgggctggatgcgagccttagac
gtaaaaaatatcatggacaattcccagaagcagcagtccgctttaaaggccaccataatg
aagaaatgtctcgttgggtataggcatattaatccgcgcttaatgagcgattttggtgat
catatattggaacggacattagaagaatacccagatagcgtgacatttgcatttgtgaaa
agaaacaaataa

DBGET integrated database retrieval system