KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL260WHelp
Entry
AGOS_AGL260W      CDS       T00167                                 

Definition
AGL260Wp
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ago00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:221933..223474
Genome map
AA seq 513 aa AA seqDB search
MATDEHTGLLPRVGGRSSKQRAVWGSLVALLVLATVVLRFDIVPRRAVAGGKRNVIFFVT
DGMGPASLAMTRAYAQAQETDTQLRLPTFQMGSMQTRSSSSLITDSAAGATAFSCAMRTY
NSAVGVGPDGRPCGTILEAAKLQGYMTGLVVTTRLTDATPAAFSSHVDHRWYEDLIAEHQ
LGTYPLGRVVDLMIGGGRTHFYGSQDTKYGDGGSRKDGRNLIDKAVEDGWQYVGDMEGFK
RLQGGHNASLPLLALLADYDIPFDMDRDDAVHPSLEQEMMTAINALTDATKDSDRGFFLL
VEGSRIDHAAHQNDPAAQAKEVLAFDRAFMSAVEFAAKSDVETVLISTSDHETGGLTVGR
QVGTAYPDYVWYPDVLRNATHSAEYLAHKLVNVPANEREDYIREKVLEKGLGIDYYSEED
LQELVVSRTTDQILDKLTRMVSLRAEIGWSTHGHTGVDVNVYAFANTGPSWKSVQDALYG
NHANVDIGSFLALYLDLDLEKVTDLIKDTKHSP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagacgagcatacagggttgctgcccagagtgggcggacggagttcgaaacag
cgggcggtctgggggtcgctggtggcgcttcttgtgctggcgacggttgtgctgcggttc
gatatagtgcccaggcgggcggtggcgggcggaaagagaaacgtgatcttcttcgtgaca
gatggcatggggcctgcgtcgctggcgatgacgcgcgcttacgcgcaggcgcaggagacg
gacacgcagctgcggctgccgaccttccagatgggctccatgcagacaaggtcctcgtcg
tcgctgatcacggactcggcggcaggcgcgacggcgttctcgtgcgcgatgcggacgtac
aatagtgcagtcggcgtggggccggacggaaggccgtgcgggacaattctggaggccgcc
aagctgcaggggtacatgaccgggctggtggttacgacgcgtctcacggacgcgacgccg
gctgccttctcgtcgcacgtggatcaccgctggtacgaggacctgattgcggagcaccag
ctcggcacgtaccctctgggccgtgtggttgacttgatgatcgggggcgggcgcacgcac
ttctacggttcgcaagacacgaagtacggcgacggcggaagcaggaaagacggacgcaac
ttgatcgacaaggcggtcgaggacgggtggcagtatgtcggagatatggaaggcttcaag
cggctgcagggtggccacaatgccagcttgccgttattggctctgctggccgactacgat
ataccatttgatatggacagggacgacgctgtgcatccatctttggaacaggagatgatg
actgcaatcaatgccttgacggatgccacaaaggactccgacagggggtttttcctgtta
gtcgagggttcgcgtattgaccacgccgcccaccagaacgatcctgcagcacaggcaaag
gaggtcctagcctttgacagggccttcatgagcgcggtggagtttgccgccaaatcggac
gtagagacggtcttaatatctacgtctgatcatgaaactggcggcctaacagttggtcgg
caggttggaacggcatacccagattatgtatggtacccagacgtgttgcgtaatgccaca
cattccgctgaatatttagcgcacaaactggtcaatgtgccagctaatgagagagaggat
tacatccgggaaaaagtcctggaaaaagggctcggaatcgattactattcggaggaggac
ctccaggagctcgtagtgtcgcggaccacggatcagattttggacaaattgacgcgcatg
gtttctctgcgggcggaaattgggtggagcacgcacggacacactggtgtggatgttaac
gtctatgctttcgcaaacacaggcccttcgtggaaatccgtccaagatgctttatacgga
aaccatgccaatgtagacataggttccttcctggcattgtacctcgacttggacttggaa
aaggtaaccgatctgattaaggataccaaacattccccttga

DBGET integrated database retrieval system