KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL273CHelp
Entry
AGOS_AGL273C      CDS       T00167                                 

Definition
AGL273Cp
Orthology
K06634  
cyclin H
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AGOS_AGL273C
  Replication and repair
   03420 Nucleotide excision repair
    AGOS_AGL273C
Transcription machinery [BR:ago03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AGOS_AGL273C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(196274..197473)
Genome map
AA seq 399 aa AA seqDB search
MDHASTPTSKLGTPRQDSTKPPGSIPSKQISDDDLYRASTQYRLWSFRPEQLRQIREELN
LRVAKVVEQRVDQYKASHPELLEEERTALEQMAVPLTADEELKLVNFYAKKVRHFGNSLE
LPTEVTATAISFFRKFFLTNSVMELHPKNILWTTIFLACKSENYFLGIDSFSKATTRKEL
ILKYEYTLLESLKFTLMNHHPYKALHGFFLDIQSVLKGKVDLDYMGLIYTSAKKKITDAL
LTDAVYMYTPPQITLAVLAIEDEALITRYLELKFPEQANAEQEQTQTDSTNAPDPSPTKN
VQDKGETSGTQKKPVPENAKQETDKEAMQFSLERLKKLIEDCQTIISRKEPVTRDEVTKI
DEKLHYCLNPALVLQRLKKKQSSVSVSPPEAKRQKLNET
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgcttcaacacctactagcaagctgggcactccacggcaagactcgactaaa
ccacctggctctataccttcgaagcagattagcgatgacgacctctaccgagcatctaca
caatataggctgtggtcattccggcccgagcagttaaggcagatacgggaagaactgaac
ctgcgggtggccaaggtagtagagcagagagtggatcagtacaaggcctcgcacccagag
ctactggaggaggaacggaccgcgctggagcagatggcggtgccactgacagcggacgaa
gagctgaaactcgtaaacttctatgccaagaaggtgcgacattttgggaactcattggaa
ctccctacagaagtcacagccactgcaatatcgtttttccggaagttctttctcaccaac
tctgtaatggagctgcacccgaagaatatcttatggacgactatattccttgcatgcaaa
tctgaaaattacttcctgggcatcgactccttctcgaaagccactacacgtaaggagctc
attctaaagtacgagtatactctgctggagtctctgaagtttactctaatgaaccatcat
ccgtataaggctttgcacggtttctttttggatatacagtcggttctgaagggcaaggtc
gacctggattacatggggcttatatacaccagtgctaaaaagaagatcacagatgcgctt
ctgacagatgcagtttacatgtatacccctccccagattaccttggcagtcttggccatt
gaggatgaagcgctaattacgagatatctggaactaaagtttcctgaacaggctaacgca
gaacaggaacagacgcaaacagacagtacaaatgcgcctgacccctctcctaccaagaat
gtccaggataaaggcgagacatctgggacacagaagaaacccgtccctgaaaatgccaaa
caagagactgacaaggaagctatgcagttttcgcttgaaagactgaaaaagctaatagaa
gattgccaaacaatcatttcacggaaggagccagtgacaagagatgaggttacgaagatc
gatgagaagctgcattattgcttaaatcctgcgctagttttgcagcgtttaaagaaaaag
cagtcttccgtcagcgtgagtccgcccgaggcgaaaagacaaaagctcaatgagacataa

DBGET integrated database retrieval system