KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL294WHelp
Entry
AGOS_AGL294W      CDS       T00167                                 

Definition
AGL294Wp
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ago04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ago04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ago04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:156970..158940
Genome map
AA seq 656 aa AA seqDB search
MDRQHSSIQQQPRMSAVLQETISQLKHLIITHIQQLNYDSAEFFSELLYADCSCTNTGNN
TGTIDESRERFDSLYYYALTLYLQGDYHSSVHVVKDALSSHLGCAYVYARCCLKLGTRYQ
DAIQALMALRDCWQNGVTNSTDLFMYPDKATVLSVMGQLSLKSHREKEAVSFLSQSLSTN
SYQLEPLSILFEMRADLQTVKLFKPVKKSWKAKHLRTANIISKPQTPFKIPSRLSTSAVG
AAPNPLLSTSSAIVSTSPSMMRRSKFLNSNSNASNATSNINNNNNVNNNGQQSTPPSKLL
NIEHNKTTPDDKLSPSQMQLLSHNPLPHKPLDQLMYWMMKAYKSYYRYDSYRAIRLLNEQ
LPSHILQNMPWCLALLSRLHFEIQNHDMSLSYFNKLRRLQPTRLKDMDVYSTLLWHLHDK
IRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGH
EYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV
ILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKL
EQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGIQLVKEALEKCHEQG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacaacatagctctatccagcaacaaccaaggatgtcagctgttctgcaggag
acaatatcacaactaaagcatttgatcataacccatattcagcagttgaactacgattca
gccgagttcttctccgaattgttgtatgccgactgctcctgcaccaacaccggcaacaac
acgggtaccatagacgagagccgcgagcggtttgattcgttgtactattatgcattgacg
ttatacttgcaaggggactaccactcctccgttcacgtggtgaaggacgcgcttagcagc
cacctaggctgcgcgtacgtgtatgcgcggtgttgtttgaagcttgggacgcgctaccag
gatgccatccaggcgctcatggcgctccgagactgctggcagaacggtgtgacgaactcc
acggacctcttcatgtacccggacaaggcgacggtgctgtccgtgatgggacagctctcg
ttgaagtcgcaccgggaaaaggaggcagtgagctttctttcgcagtctttgtcgaccaac
agctaccagttggaaccgctctccattctctttgagatgcgcgcggaccttcagacggtg
aagttgttcaagcccgtcaagaagtcgtggaaggcgaaacacttgcggaccgcaaatatc
atctccaagccgcagactccgttcaagataccgtcgcggttatccacctctgctgttggg
gcagcacccaatccactcctctcaacctccagtgccatagtatcaacctccccatccatg
atgagacggtccaaatttttaaattcaaatagcaatgccagcaacgctacgtcgaacatc
aataacaataacaatgttaataataatggccagcaatctacgccaccgtcaaaactactg
aatattgaacataataaaactacccccgacgacaagctgtcgccgtcacaaatgcaacta
ctatcacataatcctctcccccacaaaccgttagaccaattaatgtactggatgatgaaa
gcatacaagtcctactatcgttatgattcatatagagctattcgccttctcaacgagcag
ctcccctcccatattttgcagaatatgccttggtgtttagcacttctatcaaggctacac
tttgaaattcaaaaccatgacatgtctctgtcatattttaataagcttcgtcggttgcaa
ccaactaggcttaaggacatggatgtttattcgaccctcttatggcatctacacgataag
atccgcctagccgatctttgccatgaactaatggcccaagatgacaaaaactgcattaca
tggtgctgtctagggaatttgttttccctaaatcgcgaccatgatgaagccatcaaagca
ctaaaaaaagccactagcctcaacccacagtttgcatatgcatacactttacaaggacat
gagtattccaataatgatgctttcgataatgccaaaatgtgctatcggaaggcgttggct
atcaaccccaaccactataatgctcactacggtttaggcatgtcttgtatcaaactagga
cagtatgatgaagccttacttcattttgaaaaggcgcgttcaatcaacccagttaatgtt
attctgaattgctgctgcggagttgcgctagaaaggttaggacgccgcgagaaagccctt
gatttttaccaattggcatgcgaattgcaaccgaattcatcattggcgttgttcaagaaa
tcacagttgttattcaatttggggcagtatagtaacgcattacagaattttgaaaaacta
gaacaattgactcctaacgaagctcctgttcatttcttattgggacaattatatcaaata
gttggtaggaaaaaagacgctataacacaattcacaattgctatgaacttggatccaaat
ggtatccagttggtgaaagaggcgttagagaaatgccatgaacaaggttga

DBGET integrated database retrieval system