KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL294WHelp
Entry
AGOS_AGL294W      CDS       T00167                                 

Definition
AGL294Wp
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AGOS_AGL294W
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AGOS_AGL294W
   04113 Meiosis - yeast
    AGOS_AGL294W
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AGOS_AGL294W
Ubiquitin system [BR:ago04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AGOS_AGL294W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:156970..158940
Genome map
AA seq 656 aa AA seqDB search
MDRQHSSIQQQPRMSAVLQETISQLKHLIITHIQQLNYDSAEFFSELLYADCSCTNTGNN
TGTIDESRERFDSLYYYALTLYLQGDYHSSVHVVKDALSSHLGCAYVYARCCLKLGTRYQ
DAIQALMALRDCWQNGVTNSTDLFMYPDKATVLSVMGQLSLKSHREKEAVSFLSQSLSTN
SYQLEPLSILFEMRADLQTVKLFKPVKKSWKAKHLRTANIISKPQTPFKIPSRLSTSAVG
AAPNPLLSTSSAIVSTSPSMMRRSKFLNSNSNASNATSNINNNNNVNNNGQQSTPPSKLL
NIEHNKTTPDDKLSPSQMQLLSHNPLPHKPLDQLMYWMMKAYKSYYRYDSYRAIRLLNEQ
LPSHILQNMPWCLALLSRLHFEIQNHDMSLSYFNKLRRLQPTRLKDMDVYSTLLWHLHDK
IRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGH
EYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV
ILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKL
EQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGIQLVKEALEKCHEQG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacaacatagctctatccagcaacaaccaaggatgtcagctgttctgcaggag
acaatatcacaactaaagcatttgatcataacccatattcagcagttgaactacgattca
gccgagttcttctccgaattgttgtatgccgactgctcctgcaccaacaccggcaacaac
acgggtaccatagacgagagccgcgagcggtttgattcgttgtactattatgcattgacg
ttatacttgcaaggggactaccactcctccgttcacgtggtgaaggacgcgcttagcagc
cacctaggctgcgcgtacgtgtatgcgcggtgttgtttgaagcttgggacgcgctaccag
gatgccatccaggcgctcatggcgctccgagactgctggcagaacggtgtgacgaactcc
acggacctcttcatgtacccggacaaggcgacggtgctgtccgtgatgggacagctctcg
ttgaagtcgcaccgggaaaaggaggcagtgagctttctttcgcagtctttgtcgaccaac
agctaccagttggaaccgctctccattctctttgagatgcgcgcggaccttcagacggtg
aagttgttcaagcccgtcaagaagtcgtggaaggcgaaacacttgcggaccgcaaatatc
atctccaagccgcagactccgttcaagataccgtcgcggttatccacctctgctgttggg
gcagcacccaatccactcctctcaacctccagtgccatagtatcaacctccccatccatg
atgagacggtccaaatttttaaattcaaatagcaatgccagcaacgctacgtcgaacatc
aataacaataacaatgttaataataatggccagcaatctacgccaccgtcaaaactactg
aatattgaacataataaaactacccccgacgacaagctgtcgccgtcacaaatgcaacta
ctatcacataatcctctcccccacaaaccgttagaccaattaatgtactggatgatgaaa
gcatacaagtcctactatcgttatgattcatatagagctattcgccttctcaacgagcag
ctcccctcccatattttgcagaatatgccttggtgtttagcacttctatcaaggctacac
tttgaaattcaaaaccatgacatgtctctgtcatattttaataagcttcgtcggttgcaa
ccaactaggcttaaggacatggatgtttattcgaccctcttatggcatctacacgataag
atccgcctagccgatctttgccatgaactaatggcccaagatgacaaaaactgcattaca
tggtgctgtctagggaatttgttttccctaaatcgcgaccatgatgaagccatcaaagca
ctaaaaaaagccactagcctcaacccacagtttgcatatgcatacactttacaaggacat
gagtattccaataatgatgctttcgataatgccaaaatgtgctatcggaaggcgttggct
atcaaccccaaccactataatgctcactacggtttaggcatgtcttgtatcaaactagga
cagtatgatgaagccttacttcattttgaaaaggcgcgttcaatcaacccagttaatgtt
attctgaattgctgctgcggagttgcgctagaaaggttaggacgccgcgagaaagccctt
gatttttaccaattggcatgcgaattgcaaccgaattcatcattggcgttgttcaagaaa
tcacagttgttattcaatttggggcagtatagtaacgcattacagaattttgaaaaacta
gaacaattgactcctaacgaagctcctgttcatttcttattgggacaattatatcaaata
gttggtaggaaaaaagacgctataacacaattcacaattgctatgaacttggatccaaat
ggtatccagttggtgaaagaggcgttagagaaatgccatgaacaaggttga

DBGET integrated database retrieval system