KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL294WHelp
Entry
AGOS_AGL294W      CDS       T00167                                 

Definition
(RefSeq) AGL294Wp
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago04111  Cell cycle - yeast
ago04113  Meiosis - yeast
ago04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AGOS_AGL294W
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AGOS_AGL294W
   04113 Meiosis - yeast
    AGOS_AGL294W
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AGOS_AGL294W
Ubiquitin system [BR:ago04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     AGOS_AGL294W
Chromosome and associated proteins [BR:ago03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    AGOS_AGL294W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_8 ANAPC3 TPR_11 TPR_14 TPR_17 TPR_12 TPR_16 TPR_19 TPR_7 TPR_6 TPR_15 TPR_9 DUF3856 BTAD SRP_TPR_like IlvGEDA_leader
Motif
Other DBs
NCBI-GeneID: 4622666
NCBI-ProteinID: NP_986373
UniProt: Q751K0
Position
VII:156970..158940
Genome map
AA seq 656 aa AA seqDB search
MDRQHSSIQQQPRMSAVLQETISQLKHLIITHIQQLNYDSAEFFSELLYADCSCTNTGNN
TGTIDESRERFDSLYYYALTLYLQGDYHSSVHVVKDALSSHLGCAYVYARCCLKLGTRYQ
DAIQALMALRDCWQNGVTNSTDLFMYPDKATVLSVMGQLSLKSHREKEAVSFLSQSLSTN
SYQLEPLSILFEMRADLQTVKLFKPVKKSWKAKHLRTANIISKPQTPFKIPSRLSTSAVG
AAPNPLLSTSSAIVSTSPSMMRRSKFLNSNSNASNATSNINNNNNVNNNGQQSTPPSKLL
NIEHNKTTPDDKLSPSQMQLLSHNPLPHKPLDQLMYWMMKAYKSYYRYDSYRAIRLLNEQ
LPSHILQNMPWCLALLSRLHFEIQNHDMSLSYFNKLRRLQPTRLKDMDVYSTLLWHLHDK
IRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGH
EYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV
ILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKL
EQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGIQLVKEALEKCHEQG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacaacatagctctatccagcaacaaccaaggatgtcagctgttctgcaggag
acaatatcacaactaaagcatttgatcataacccatattcagcagttgaactacgattca
gccgagttcttctccgaattgttgtatgccgactgctcctgcaccaacaccggcaacaac
acgggtaccatagacgagagccgcgagcggtttgattcgttgtactattatgcattgacg
ttatacttgcaaggggactaccactcctccgttcacgtggtgaaggacgcgcttagcagc
cacctaggctgcgcgtacgtgtatgcgcggtgttgtttgaagcttgggacgcgctaccag
gatgccatccaggcgctcatggcgctccgagactgctggcagaacggtgtgacgaactcc
acggacctcttcatgtacccggacaaggcgacggtgctgtccgtgatgggacagctctcg
ttgaagtcgcaccgggaaaaggaggcagtgagctttctttcgcagtctttgtcgaccaac
agctaccagttggaaccgctctccattctctttgagatgcgcgcggaccttcagacggtg
aagttgttcaagcccgtcaagaagtcgtggaaggcgaaacacttgcggaccgcaaatatc
atctccaagccgcagactccgttcaagataccgtcgcggttatccacctctgctgttggg
gcagcacccaatccactcctctcaacctccagtgccatagtatcaacctccccatccatg
atgagacggtccaaatttttaaattcaaatagcaatgccagcaacgctacgtcgaacatc
aataacaataacaatgttaataataatggccagcaatctacgccaccgtcaaaactactg
aatattgaacataataaaactacccccgacgacaagctgtcgccgtcacaaatgcaacta
ctatcacataatcctctcccccacaaaccgttagaccaattaatgtactggatgatgaaa
gcatacaagtcctactatcgttatgattcatatagagctattcgccttctcaacgagcag
ctcccctcccatattttgcagaatatgccttggtgtttagcacttctatcaaggctacac
tttgaaattcaaaaccatgacatgtctctgtcatattttaataagcttcgtcggttgcaa
ccaactaggcttaaggacatggatgtttattcgaccctcttatggcatctacacgataag
atccgcctagccgatctttgccatgaactaatggcccaagatgacaaaaactgcattaca
tggtgctgtctagggaatttgttttccctaaatcgcgaccatgatgaagccatcaaagca
ctaaaaaaagccactagcctcaacccacagtttgcatatgcatacactttacaaggacat
gagtattccaataatgatgctttcgataatgccaaaatgtgctatcggaaggcgttggct
atcaaccccaaccactataatgctcactacggtttaggcatgtcttgtatcaaactagga
cagtatgatgaagccttacttcattttgaaaaggcgcgttcaatcaacccagttaatgtt
attctgaattgctgctgcggagttgcgctagaaaggttaggacgccgcgagaaagccctt
gatttttaccaattggcatgcgaattgcaaccgaattcatcattggcgttgttcaagaaa
tcacagttgttattcaatttggggcagtatagtaacgcattacagaattttgaaaaacta
gaacaattgactcctaacgaagctcctgttcatttcttattgggacaattatatcaaata
gttggtaggaaaaaagacgctataacacaattcacaattgctatgaacttggatccaaat
ggtatccagttggtgaaagaggcgttagagaaatgccatgaacaaggttga

DBGET integrated database retrieval system