KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL301CHelp
Entry
AGOS_AGL301C      CDS       T00167                                 

Definition
AGL301Cp
Orthology
K14298  
mRNA export factor
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AGOS_AGL301C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(139480..140565)
Genome map
AA seq 361 aa AA seqDB search
MSLYRPTGSASTSSAMATDKELSNDITINNPANDSVSDIAFSPQQDFLFSVAAWDNTVRI
WDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQAQQIGSHDSA
VRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQPISTVAMPERVYALDSKQKLLVVGT
AERHIVVIDLNNPAQVFRTSMSPLKWQTRTVACYIEGNGFAIGSVEGRCAIQYVDEQEQR
KNGFSFKCHRQQQPASGRASSESLVYPVNSIVFHPQYGTFATAGGDGSCNFWDKNQRHRL
KGFPSMNASIPVCNFNRNGSVFAYALSYDWHQGYMANRPDYPNVIRLHATTDDEVKEKKK
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatatcgtcctacgggctctgctagcacatcatcggcgatggcaacagacaag
gaactctccaacgatataacgatcaacaatccggctaacgactcggtatctgacatcgca
ttctcgccacaacaagacttcctgttcagcgttgccgcgtgggacaatacagtgcgcatc
tgggacgtgcagaatggtatgacgcaaggtcgtgcgcagtacgaacaccaggcgcctgtg
ctgacgacccgatggtcatctgacgggaccaaggtagcctctgggggctgcgataacata
cttaagctgtacgacgtggcgagcgggcaggcgcaacagataggcagtcatgactcggcc
gtgcgcgccctgcggtttgtgcagtgcgggccgtccaaccaggaatgcatcgtcacgggc
tcgtgggacaagaccatcaagtactgggacatgcgccagccacagccgatctccacggtc
gcgatgccggagcgcgtgtacgcactggacagcaaacagaaactgctcgtagtcggcaca
gctgagcgccacattgtcgtcattgacctgaacaacccggcgcaggtcttccgcacctcc
atgtcgccgctcaagtggcagactcgcacggtcgcctgctatatcgagggcaatggtttt
gccattggttccgtggagggccgctgcgccatccagtacgtcgacgagcaagagcagcgc
aaaaatgggttctccttcaagtgtcatcgccagcagcagcccgcatctggccgcgcctcc
tccgagtccctcgtttacccggtcaacagcattgtcttccacccgcagtatggcaccttc
gccacggctggcggcgatggctcctgcaatttctgggataagaaccaacgccatcgcctc
aagggcttcccgtcaatgaatgcgtccattcctgtttgtaacttcaacagaaacggttcg
gtctttgcatacgccctaagctacgattggcaccagggctacatggccaaccgaccagat
tatccaaatgttatccgcctccatgctaccaccgatgatgaggttaaggagaaaaagaag
cgctga

DBGET integrated database retrieval system