KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL316WHelp
Entry
AGOS_AGL316W      CDS       T00167                                 

Definition
AGL316Wp
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AGOS_AGL316W
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AGOS_AGL316W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:112950..113915
Genome map
AA seq 321 aa AA seqDB search
MSSWQTIENDAGVFTQLVKDLGVEGVQFEEVPLVEHLATLNSPLYGVIFLFKYERQNYAG
EAPVQGEFEQACPEGLFFAQQTIPNACATQAVLNTLLSIGNDHRNSIRLGTVLSDFLQFT
AGFSDPALRGETITNSVAIRNVHNSFTSPDPFEHEEPSPSAQSSEAAFHYSGFVPYNGYI
YELDGLHPRPIIHRAYGANNDDPAVFAANLAALLSARMSMVADSSFSVTAIVRDKLEHLT
EQLDAPDVDDGRRFWLQDLIQDELRVRDRWAKEIALRRDGLVGLVYAVFKQMLGSMSDDE
FAQRRAAAAARTNERERRRTC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggcaaacaattgaaaatgatgcgggggttttcacacagctagtcaaagat
ctaggcgtggagggcgtgcagttcgaggaggtaccgctggtggagcaccttgccacactg
aattcgccactgtacggcgtgatcttcctgttcaagtacgaacgccaaaactacgcgggc
gaggcaccagtgcagggagagttcgagcaagcgtgtcccgagggcctgttcttcgcgcag
cagacgattccgaacgcgtgtgctacgcaggccgtgctcaacacgctgctgtcgattggc
aacgaccaccgaaacagcatccggctgggaaccgtgttgtccgatttcctgcagttcacc
gcgggcttcagcgaccccgcgctccgtggcgagaccatcaccaactctgtcgcgatccgc
aacgtccacaactccttcacaagcccggacccgttcgagcacgaggagccgagcccgtcc
gcccagtcgagcgaggccgccttccactactctggcttcgtcccgtacaacggctacatc
tacgagttagacgggctgcacccgcgcccgatcatccaccgggcgtacggtgccaacaac
gacgacccagcggtctttgccgcaaatctcgccgcgctactctccgccaggatgagtatg
gtcgccgacagcagcttctccgtgaccgcaattgtgcgtgacaagctcgagcatctgacc
gaacagctcgacgcccccgacgtcgacgacggccgccgcttctggctgcaggacctgatc
caagacgagctacgcgtgcgcgaccgctgggccaaggagatcgcgctgcgtcgcgacggc
ctggtcggccttgtgtacgccgtcttcaagcagatgctcggctctatgtccgacgatgag
tttgcccaacgccgcgcagcggctgctgcccgtaccaacgaacgcgagaggcgccgcacg
tgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system