KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR024CHelp
Entry
AGOS_AGR024C      CDS       T00167                                 

Definition
AGR024Cp
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_AGR024C
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AGOS_AGR024C
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AGOS_AGR024C
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGOS_AGR024C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AGOS_AGR024C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1076692..1078125)
Genome map
AA seq 477 aa AA seqDB search
MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD
VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA
LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQL
GYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE
FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE
KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA
KTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFKNYRYHNKFTLPTEAAVQAYIT
GTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMDNDSFLHWNY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgataagaagcaccgttagaggcatggtccagagaaggcagatgtcgtctttagtcaag
ttcaaaacgaataacacggcccgtgtggtcacgctcaatcggcccgagaagctgaacgcc
atcaaccatgagatctgccactcgattctgccggtgatgcaggagtacgccaaaagcgat
gtggccaacgtgattgtgttcgactctgcgtgcgcgccacgggcgttctgcgccggtggc
gacatcgtgctgatggcgaaggccatgcggcgggacatgctggagaaggtggacgacttc
ttccagggcgagtacaccatgaactggatgctggcgacgtacccgaagcctgttgtcgcg
ctgatggacgggatcacgatgggtggcggcgtggggctgacgatccacgtgccgttccgc
gtggcgaccgagaacacgaagtgggcgatgccagagctggatatagggttgcaccccgat
gtgggggtgtcctttgcgctgcccaggatcatgacgctcggcggacaagagggccagctc
gggtactacctgtgcctgaccggcgaggtgctccagggggctgacgtctacatggcgggc
cttgcctcgcactatgtcgagagcacacagcatggcgcgctgaaggagcgcctcgggacg
gttccgataacccgcaaggccgacgagacgtttgccaacaccaacgccgtcatcgaggag
ttctcgtctcctctgccagacggctaccaattcaagtacaacaaggaagaattggatgtg
atcgagcggttcttccactacgacgtctcctacaaggaattgcgcaagaacctcgaggcg
tttgccagttcgaatgcgaactcggaagtcgcccgtaactttgccaaggcaaccttggag
aagctctccacaaagtccaccgtttctgctgagatcacccgcgagcaattccgccggaac
tcccaacgtgacatccagtccgccatgaagcaagacctcattaccagcacgaacctgttg
cggaacaacgaactagcggagttcgaaaacgcggtcatccataagctggtggagaaggcc
aagacaccctacgagtggaagaatacgtcaccttcggtcgcagatatatccaaactgcta
gctgcggacccagccaacccaatcgacctgctggaaaccttcggagtcacgttcaagaac
taccgttaccacaacaagttcacgctccccaccgaagccgcggtccaggcatacatcacc
ggcactgaccagtctggcaggtcaatggccgttacaagggcggagactgtcaagtatttc
acggaatttaaccctgtaagccggggtaaagttggtactgaatatgttgtcaacttgatc
atcgaccggaaatgcagaatggataatgattccttcctacactggaactattag

DBGET integrated database retrieval system