KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR024CHelp
Entry
AGOS_AGR024C      CDS       T00167                                 

Definition
AGR024Cp
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ago01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ago00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ago00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ago00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1076692..1078125)
Genome map
AA seq 477 aa AA seqDB search
MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD
VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA
LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQL
GYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE
FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE
KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA
KTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFKNYRYHNKFTLPTEAAVQAYIT
GTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMDNDSFLHWNY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgataagaagcaccgttagaggcatggtccagagaaggcagatgtcgtctttagtcaag
ttcaaaacgaataacacggcccgtgtggtcacgctcaatcggcccgagaagctgaacgcc
atcaaccatgagatctgccactcgattctgccggtgatgcaggagtacgccaaaagcgat
gtggccaacgtgattgtgttcgactctgcgtgcgcgccacgggcgttctgcgccggtggc
gacatcgtgctgatggcgaaggccatgcggcgggacatgctggagaaggtggacgacttc
ttccagggcgagtacaccatgaactggatgctggcgacgtacccgaagcctgttgtcgcg
ctgatggacgggatcacgatgggtggcggcgtggggctgacgatccacgtgccgttccgc
gtggcgaccgagaacacgaagtgggcgatgccagagctggatatagggttgcaccccgat
gtgggggtgtcctttgcgctgcccaggatcatgacgctcggcggacaagagggccagctc
gggtactacctgtgcctgaccggcgaggtgctccagggggctgacgtctacatggcgggc
cttgcctcgcactatgtcgagagcacacagcatggcgcgctgaaggagcgcctcgggacg
gttccgataacccgcaaggccgacgagacgtttgccaacaccaacgccgtcatcgaggag
ttctcgtctcctctgccagacggctaccaattcaagtacaacaaggaagaattggatgtg
atcgagcggttcttccactacgacgtctcctacaaggaattgcgcaagaacctcgaggcg
tttgccagttcgaatgcgaactcggaagtcgcccgtaactttgccaaggcaaccttggag
aagctctccacaaagtccaccgtttctgctgagatcacccgcgagcaattccgccggaac
tcccaacgtgacatccagtccgccatgaagcaagacctcattaccagcacgaacctgttg
cggaacaacgaactagcggagttcgaaaacgcggtcatccataagctggtggagaaggcc
aagacaccctacgagtggaagaatacgtcaccttcggtcgcagatatatccaaactgcta
gctgcggacccagccaacccaatcgacctgctggaaaccttcggagtcacgttcaagaac
taccgttaccacaacaagttcacgctccccaccgaagccgcggtccaggcatacatcacc
ggcactgaccagtctggcaggtcaatggccgttacaagggcggagactgtcaagtatttc
acggaatttaaccctgtaagccggggtaaagttggtactgaatatgttgtcaacttgatc
atcgaccggaaatgcagaatggataatgattccttcctacactggaactattag

DBGET integrated database retrieval system