KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR139CHelp
Entry
AGOS_AGR139C      CDS       T00167                                 

Definition
AGR139Cp
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AGOS_AGR139C
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AGOS_AGR139C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1327600..1330041)
Genome map
AA seq 813 aa AA seqDB search
MPDPKENQGSYSMYPASPVPPATQMPPAAAANSYLYSNAYHSQYNYGYPVGIEIYPSQTM
QYMGYHQPAMTYGGYGGPGQGAVPVKKKFYGNGTNYKKEQAGGGAGGGAGGAEGRPVQVT
IKNLFKFELGNSNCVRVDGLKIEYPMYVNTTPEEFAQAKLKRHMLRLEALRELDGRKAPV
AREEKDKRAASEQKQRDAPAPGGAHGATNAVENEKVEKRDTRKEEPHARKEAEVPQATPR
EPKEADVDTTSQKVFTSPRREDQKPSVASQKKRDDVPAPANTPLKSEEKKGEPSGRTMKS
WSQVASNAASKKPIPANVSLAAKKEKRYIPSSIKGSEPLGTVALRMCLDKDYINYVSSTM
PESAKAIKLGIPRGIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLL
GSCLEFYKEFEKLHADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKLPMFKDL
QWGHQEDAEEFLTHFLDQLHEEFVSSINSLSCSDMIHLLQSLSDDDLKAEFVRSLSKYKR
AEFIKNMSSELKALIDKYGSALEYDTSEGSENSSEWHEVSKKGKKTRNTVKRTTELEPSP
IMSIFGGEYRSVLDIPQNKESHSITLDPFYTLHLHISDPEVNDLESAFKKFSDFEYLSYK
ADSGNDVEAKKQAFLDRLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRY
DQELTIPKEALSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADVLHQTQDKWYRI
DDNNVTEIRQEDVFKRGDEASDSKTAYILIYQR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgccagatccaaaggagaatcaaggaagttattcgatgtatcccgcatcgcctgtgcct
cctgcaacgcagatgccaccagcagcagcagcgaactcgtacctgtactcgaatgcatac
cattcgcagtacaactatgggtatccggtcggtattgagatctacccatcacagacgatg
caatacatggggtatcatcagccggccatgacctacggaggctacggcgggcccggacag
ggggcggtgccggtgaagaagaagttctacgggaacggcacgaactacaagaaggagcag
gcgggcggcggagcgggcggcggggccggcggggcggaggggcggccggtgcaggtgact
atcaagaatctgttcaagttcgagttggggaacagcaactgcgtgcgcgttgacgggctg
aagatcgagtatccaatgtatgtgaacacgacaccagaggagtttgcgcaggcgaagctg
aagcggcacatgctgcgactcgaggcgctgagagagttggacgggagaaaggccccggtc
gcgcgcgaggagaaggacaagcgggctgcttcggaacagaagcagcgcgatgcgccggca
cccggcggggcacatggcgctacaaatgcggtagagaatgagaaagttgaaaaaagagac
acacggaaagaagagccgcatgcgcggaaggaagcagaagttccacaggccacgccgagg
gagccaaaggaggcagatgtagacaccacgtcgcagaaagtattcacatccccacgccgc
gaagaccagaaaccctctgtagcttctcagaaaaagcgcgacgacgtgcctgctcccgcc
aacacgcctctgaaatctgaagagaaaaaaggcgagccctcaggccgcacgatgaagtct
tggtcgcaggttgcctcgaatgctgctagcaagaagccaataccggccaacgtttccctc
gctgcgaagaaagaaaagagatatattccttccagcatcaaaggttctgagccattggga
acagtggcactacggatgtgccttgataaagactacataaactatgtgagcagcaccatg
ccggaatccgcaaaagctatcaagcttggtatcccacgaggtattatgaacaaaggtaat
atatgcttcatgtcatccgtattacaggtccttctattttgtgagccttttattgagatg
ttaaatgttgttcatgcgagaacgggcgtcaagtcgtggacactgttaccccctctgcta
ggttcatgtctcgaattttataaggaatttgagaagttgcatgcggacaaggacaaaaac
gataaacaaagcaacggtaacggcaagtccgcgaaggctaacaggtccagtcaacccgat
gctatcgatccagagcatttctataagtgcatttcaaagctgccaatgtttaaggatctt
cagtggggccaccaggaagatgcagaggagtttttgacgcattttctcgatcagttgcac
gaagaatttgtgtcatcgatcaactctttgagttgtagtgacatgattcatctgctgcag
agcctctccgatgacgatttgaaggcggaattcgttaggtctttgtccaagtacaagcgt
gcggaattcataaaaaacatgagttcagaacttaaggcgttgattgataaatacggcagt
gctttggaatatgatacctctgaaggttccgagaattcatccgaatggcatgaagtcagc
aagaaggggaaaaagacaaggaatactgttaagagaactacggaactagagccatctcct
ataatgtccatatttggcggtgagtaccgttctgtgctggacattccccagaataaggaa
tcgcattctattactctggatcctttctacaccctgcatctgcatatatccgacccagag
gtcaacgatctcgaatctgccttcaagaaattcagcgactttgaatacttatcctacaag
gccgattctggtaacgatgtagaagcaaaaaaacaggcatttttggaccggctaccgcgt
gttctattaatacagttgaaacggtttgagtttgtaaacaacagctcagagagacgtgag
cttattaactacaacgcgtacaacggccgcatagaaaaaatccgcaagtggatcagatac
gatcaggagctgacgattcctaaggaggctttatcctcggtgaatgcgaagttttatcta
tccggtaaggatactacctatagattaactggtgttgtgtatcatcacgggttgtccccc
agcggaggacactacaccgcggatgtcctacatcagacacaggataaatggtacaggatc
gatgataataacgttacagaaatcagacaggaggatgttttcaagcgtggagacgaagca
tcagattccaagactgcctacatattgatataccaaaggtga

DBGET integrated database retrieval system