KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR183CHelp
Entry
AGOS_AGR183C      CDS       T00167                                 

Definition
AGR183Cp
Orthology
K11252  
histone H2B
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AGOS_AGR183C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1412493..1412891)
Genome map
AA seq 132 aa AA seqDB search
MSSKASKAPASKAPAEKKPAAKKTSSSVDASKKRTKTRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaaagcatccaaggcccctgcctccaaggcccccgccgagaagaaacccgcc
gccaagaagacgtcgtcctccgtggacgcgtccaagaagcgcaccaagaccagaaaggag
acctactcctcgtacatctacaaggtcctgaagcagacccaccccgacaccggtatctcc
cagaagtccatgtccattctgaactccttcgtcaacgacatctttgagcgcattgcctcc
gaggcctccaagctggccgcgtacaacaagaagtctaccatctccgcgcgtgagatccag
actgccgtgcgtctgatcctaccgggtgagctggccaagcacgcggtctccgagggcacg
cgcgccgtcaccaagtactcgtcttccacgcaggcttga

DBGET integrated database retrieval system