KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR201CHelp
Entry
AGOS_AGR201C      CDS       T00167                                 

Definition
AGR201Cp
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AGOS_AGR201C
Transfer RNA biogenesis [BR:ago03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AGOS_AGR201C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1447095..1448897)
Genome map
AA seq 600 aa AA seqDB search
MSRDLWSRCSLVLKSFRLLPCDEVEQARRKTRFCESSTPVLRMGGKVKGEKNNRQKLASE
KERFLQCCSDITVELVESLSNGSTREVNLNGLITRYSKKYRLKQQPRLTDIINSIPDQHK
KYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTG
YEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYIIMGGTFMSLPREYREDFIVKL
HNALSGFNGSDIDEAIRYSQQSLTKCVGITIETRPDYCTRTHLDDMLKYGCTRLEIGVQS
LYEDVARDTNRGHTVKSVCETFAVAKDAGYKIVSHMMPDLPNVGMERDIEQFKEYFENPA
FRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVARIMALVPPWTRIYRVQRDI
PMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGIQEVHHKVHPEQVELIRRDYYA
NGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTAQRTSIVRELHVYGSVVPLHSR
DPRKFQHQGFGTLLMEEAERIAREEHGSQKISVISGVGVRNYYARLGYELDGPYMSKSLI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtgacctatggtctcgatgttcgcttgttctgaaatcttttcgcctcttacca
tgcgatgaggttgaacaggcgagacgcaagactaggttctgcgagtcatctacacctgtg
ttgagaatgggaggcaaagtcaagggcgagaagaacaaccggcagaagcttgcctcggag
aaagagcggtttctgcagtgctgctcggacatcacggtggagctggtggagtcgctgtcc
aacggctccacgcgggaggtgaacctgaacgggctgattacccggtactccaagaagtac
cggctgaagcagcagccgcggcttacagacatcattaactcgatcccagaccagcacaag
aagtacctgttgccgaagctgaaggccaagccggtgcggacggcctccgggattgcggtt
gtagcggtgatgtgcaagccacaccgctgtccgcacattgcgtacacggggaacatctgt
gtgtactgccctggcgggccggactcggactttgagtactccacgcagtcctacaccggg
tacgagcccacctcgatgcgcgcgatccgcgcgcggtacgacccgtatgagcaggcgcgc
gggcgggtcgaacagctcaagcagctaggacactcgatcgacaaggtggagtacatcatc
atgggcggcacctttatgtcgttgccgcgcgagtaccgcgaggacttcattgtgaagctg
cacaacgcgctgtcgggctttaacgggagcgacatcgacgaggccatccgctattctcag
caatcgctgaccaagtgcgtgggtatcaccatcgagacgcggcccgactactgtacgcga
acccatctcgacgatatgctgaagtatggatgcacaagacttgaaatcggcgtgcagtcc
ctatatgaagatgttgcacgggataccaacagaggacacaccgtgaagtccgtgtgcgag
acgtttgcggttgcgaaggacgctggctacaagattgtgtcccacatgatgcctgacctg
cccaacgtcggcatggagcgggacatcgagcagttcaaagagtactttgagaacccagca
ttccgcacggacggcctgaagatatacccgacgctcgttatccgtggcactggcctgtat
gagctgtggaagacaggccggtacaagtcttacaatgccaacgccctggtcgacctggtg
gcacgtatcatggcgttggtgccgccctggaccagaatctaccgtgttcagagagacata
cccatgccactggtcacctcgggcgtggagaatgggaatctgcgggagctcgcgctagcc
cggatgaaggattttgggacaacctgcagagacgtacgcactagagaggtgggaatccaa
gaggtgcaccataaagtacaccctgagcaggtggagctgatacgcagggactactacgcg
aacggcggctgggagacgttcctctcctacgaggatcccaaacaggatatcctgatcggt
ctgctccgcctgcggaaggcctccaagaaatacacctacaggaaagagttcacggcacag
cggacctcgatcgtgcgggagctgcacgtctacggctcggtcgtcccgctgcactcgagg
gacccgcgcaagttccagcatcaggggttcggcacgctgctcatggaggaggccgagcgc
attgccagggaagagcacggctcccagaagatatccgtcatctccggggtcggcgtcagg
aactactacgcccggctcgggtacgagctggacgggccctacatgtcgaagagtctcata
taa

DBGET integrated database retrieval system