KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR225CHelp
Entry
AGOS_AGR225C      CDS       T00167                                 

Definition
(RefSeq) AGR225Cp
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AGOS_AGR225C
  Amino acid metabolism
   00220 Arginine biosynthesis
    AGOS_AGR225C
   00330 Arginine and proline metabolism
    AGOS_AGR225C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AGOS_AGR225C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1489694..1490893)
Genome map
AA seq 399 aa AA seqDB search
MAQRNCWRRSWLGVGGGLCLGAHGAARGPRQLFHLTAKQSSAASDAKCRRWRAAGRGGGA
GGVYNGRGAAAGSRQTSGMAHNEHPHYKFFESKKASLVMAPFSGGQGKSGVEDGPKYLLK
QGLREGVEGLGWEIEVQRPLDGHDFEERKQRATEVVGRAKNPTLVGEATHLIHDAVRAAA
HAGRLPVTLGGDHSIAIGTVSGVLDRYPDAGLLWVDAHADINTLASTESGNLHGCPVSFL
MGLERESWPAPLAWVPGTLRPSKIAYIGLRDVDPEEKEILRRLGITAFSMYHVDRYGINK
VVEMALAAINPDGTGPVMVSYDVDAIDPMYVPATGTPVRGGLTLREGLFIVERVAETGNL
VALDVVECNPELAAHDLHVVDTVQTGCSIARCALGETLL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagaaactgctggcgccgttcctggctcggagtgggcggcggtttgtgtctg
ggcgcacacggcgccgcgcgcgggcctcggcaactttttcacttaactgcaaaacaaagc
tcagcggcaagcgatgctaagtgcaggcgctggagagcggcggggcgcggcggcggggcg
ggtggcgtatataacgggcgcggcgcggccgcaggcagcaggcagacaagcggcatggca
cacaacgaacacccccactacaagtttttcgagagcaagaaggcgtcgctggtgatggcg
ccgttcagcggcgggcagggcaagtcgggcgtggaggacggccccaagtacctgctgaag
cagggcctgcgcgagggcgtggagggcctcgggtgggagatcgaggtgcagcggccgctg
gatgggcacgacttcgaggagcgcaagcagcgcgcgacagaggtggtcgggcgcgcgaaa
aacccgacgttggtgggcgaggcgacgcacctgatccacgacgcggtgcgcgcggccgcg
cacgcggggcggctgccggtgacgctgggcggcgaccactcgattgccatcggcacggtg
tccggcgtgctggaccggtacccggacgcgggactgctgtgggtggatgcgcacgcggac
attaacacgctggcgtcgaccgagtccggcaacctgcacgggtgcccggtgtcgtttctg
atgggcctggagcgcgagagctggcccgcgccgctggcgtgggtgccgggcacgctgcgc
ccgtccaagatcgcgtacatcggcctgcgcgacgtggaccccgaggaaaaggagattctg
cgccgcctcggcatcaccgccttctccatgtaccacgtggaccgctacggcatcaacaag
gtcgtggagatggcgctggcggccatcaacccggacggcacggggccggtcatggtgagc
tatgacgtcgacgcgatcgaccccatgtacgtgcccgccaccggcacgcccgtgcgcggc
ggcctgacgctgcgcgagggcctgttcattgtcgagcgcgtggctgagacgggtaacctg
gtggcgctcgacgtggtcgagtgtaacccggagctagccgcccacgacctgcacgtggtc
gacacggtccagacgggctgctccatagcgcgctgcgcgctcggcgagactctcctttag

DBGET integrated database retrieval system