KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR256WHelp
Entry
AGOS_AGR256W      CDS       T00167                                 

Definition
AGR256Wp
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AGOS_AGR256W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AGOS_AGR256W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:1541114..1542853
Genome map
AA seq 579 aa AA seqDB search
MLGLYKYTKSYSRAILGSAGVVVKEQGSGNSAQAAEGALDDSDSQSSAMLETASLISCVT
CLSDNMDSHSTDPLLLQSNTVIPYAKILNARLALEAPAEGGADDSFTEGARSVQDAEISS
KPGSSSSRARAEGGMKSGGVLVDIVFAKPRRNDLVPKTVTLFVEYSSDDFYGGGEADVVE
EILRRSYMNTKRNKSILVIINPYGGKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAA
EIAATMDINKYDVIACASGDGIPHEVLNGLFTRPDRVAAFNKLAITQLPCGSGNAMSISC
HGTSNPSYASLSLVKATEARVDLMCCTQPSYASSPRVSFLSQTYGVIAESDINTEFMRWI
GPARFELGVTLNIFQRRKYPCQLYVKYAAKTKNELREHFTLHKARITQSFRSELMDSGSH
LADLPSTDSDLIDDSCFHLKWSLDEPVPQDWEEIDTSLTDNLGIFYVGKMPYIAPDTKFF
PAALHDDGAMDMVITDARTPLTRIAPILLSLDKGSHVLQPEVEHSKIEAYRLIPKLKSSI
ISVDGENFPFEPIQVEVLPRLAKTLLKNGCYVETEFEAL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcctgtacaagtacacgaagtcctactcacgggcgatattgggcagtgctgga
gttgtagtcaaggagcagggatcgggaaactcggcccaggcggcggagggcgcgctggat
gattcagacagccaaagcagtgcgatgcttgagacggcgtcgttgatcagctgtgtgacc
tgcttgagcgacaacatggattcgcacagcacggatccgctgctgctgcagtccaacacg
gtgattccgtatgcgaaaatattgaacgcacggttagcactagaagctcccgctgagggt
ggtgcagatgactcgttcacggagggagcgaggtccgtgcaggacgcagagatcagctcc
aaaccgggaagctccagctcaagggcgcgtgcagaaggcggcatgaagagcggaggggtg
ctggtggatatcgtttttgcgaaaccaagaaggaacgaccttgtccccaaaacagtgacg
ctatttgttgagtactcgtcggacgacttctatggcggcggcgaggccgacgtggtagaa
gagatattgcgtaggagctacatgaatacgaagcgtaacaaaagcattctcgtcatcatc
aacccatacggtgggaagggtaaagcgcataagctatatgtcacaaaagcgaagccaata
cttgtggctagtgattgtcaaattgacgtagtggaaaccaagtactcctcgcatgccgct
gagattgccgccactatggatatcaacaagtacgacgtcatagcgtgtgcatctggcgac
ggtattccacatgaggtactcaatggactatttacacgtccggaccgcgtcgcagccttc
aacaagcttgctatcacgcagctcccatgcggttctgggaatgccatgagtatctcttgt
catgggacaagcaatccgtcatacgcgtccttgtctttggtaaaggcaacagaagcacga
gttgaccttatgtgctgcacgcagccctcgtacgcaagctcgcccagagtctcgtttctc
agtcaaacatatggtgtgattgcggaatcagacataaatacagagttcatgagatggata
ggaccggcaaggtttgaactcggtgtgaccttgaacatatttcaaagacggaagtaccca
tgtcaactgtatgttaagtacgccgcaaagaccaagaacgagttgcgggagcattttaca
ctccataaggctcgcattacgcagagctttagatcagagcttatggactccggatcacat
ttggctgatctgccatctactgacagcgatctcattgacgattcgtgctttcatttgaag
tggtctttagatgagcccgtcccccaagattgggaagagattgatacaagtttgaccgac
aatttgggcatcttctatgttgggaagatgccatacatagcaccggatactaagttcttc
cctgcggcgctccacgacgatggtgctatggacatggttatcaccgatgcgcgcacgcca
ctaactagaattgccccgatcttgctctcattggataagggttcccatgtgctccaacca
gaagtggagcattccaagatagaggcttatagattgataccaaaattaaaaagtagcatc
atatctgtggatggtgagaactttcctttcgaacctattcaggtggaagtgttacctcgg
ttggctaaaactttactaaaaaatggctgctatgtggaaaccgagttcgaggccctatga

DBGET integrated database retrieval system