KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR335CHelp
Entry
AGOS_AGR335C      CDS       T00167                                 

Definition
AGR335Cp
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AGOS_AGR335C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AGOS_AGR335C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1674115..1674846)
Genome map
AA seq 243 aa AA seqDB search
MCQGGSKGLVRQDTPLKTRPVSPYTLQAPVEADGLSWPSAGARVRVEEGTEEEAARAARI
ADAVKTILTELGEDVTREGLLDTPQRYAKAMLYFTKGYQDNILNDVINNAVFDEDHDEMV
IVRDIEIHSLCEHHLVPFFGKVHIGYIPRRRVLGLSKLARLAEMYARRLQVQERLTKQIA
MALQDILRPRGVAVVVEATHMCMVSRGVQKSGSSTVTSCMLGCFRDMHKTREEFLNLLRN
RSV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaggggggcagtaaaggactagttaggcaggacacgcccctaaagacgaggcct
gtctcgccatatacgctccaggccccagttgaggcggacggactgtcctggccgagtgca
ggggcacgtgtgcgggtcgaggagggcacggaggaagaggcggcacgcgcagcccggata
gctgatgcagtcaagacgattttgacggagctgggcgaagacgtgacgcgggagggcctg
ctggacaccccgcaacggtacgccaaagcgatgctgtacttcaccaagggctaccaagac
aatattttgaacgatgtgatcaataatgctgtgtttgacgaagatcatgacgagatggta
attgtgcgggatattgagatccattcgctgtgcgagcaccacctggtacccttcttcggg
aaggtgcatattggctacatacctcggaggagagtcctcgggttgtcgaagctcgcccgg
ctagcggaaatgtacgcgcgcaggctgcaggtgcaggagcggctgacgaagcagattgcg
atggcattgcaggatatactgcgccctagaggagtagccgttgtggtggaggccacgcat
atgtgcatggtgtcacggggggtccagaagtccgggtcctcaactgtcacctcgtgtatg
ctgggctgcttcagagacatgcacaagacccgggaagaattcttgaacctcttgagaaat
agaagtgtatag

DBGET integrated database retrieval system