KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR370WHelp
Entry
AGOS_AGR370W      CDS       T00167                                 

Definition
AGR370Wp
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:1733689..1735911
Genome map
AA seq 740 aa AA seqDB search
MAFKKWLPRSEKHKRNGPGENGQGGEAELEEARGREDAGCVANGGGERKDGGEDAHREYL
RYLQQTGEGRDGVQELLFARPAGKDRRLLPFGDGTPKVFGLENYGNTCYCNSVLQCLYNL
KELRVNVLKYPTRAEPTERIRRPDSGLLRPRAASDSGPATTAVGGEGESARRASIGAPVP
STKGLVRRRSLNFFSRGAQARRGKDLQQNGTAPGLESQQNGGTKQEPEQNGDTQQSCNDS
GNEFIYKEALDEDGTAADTNGATLALENVASRDNMAADPIMEMIHEGYGKVIVGRLQTKN
AQLQRSLTTLTTMVHSESRNPSASSSTSTASSGTAAGSGALRQSSSPVYASNMSSEQRKK
AALITGPVLCIDQPMHSNYFPSDMEPTLYNALKDVFECIAESNHMLGVVSPSHFVSVLRK
ENVLFNSMMHQDAHEFLNFLMNALSDSLQLQLQRLPDKSPENFIHTLFQGTMNNSIKCLT
CDNITSNEEPFFDFAIPVSEDEEVNVQDILRDFHQREMLNGANKFYCDSCNGLQEAERTV
GIKELPELLPLHLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIH
MGGGPQHGHYVAICKHELFGWLLYDDETVESVGEDAVLRFIGDVNDMTTAYVLFYKSKRE
DDDTPAELQDYNANIDQLLKYDDWMRRRSASSAVPVASYAATLEEVPEEKDSHYIRTSDN
GTVKQKAKMFRLKRSKASCK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaagaaatggcttcccagaagtgaaaagcacaagcggaacggaccgggcgaa
aacggacagggcggggaggcagagctggaagaagcgagggggagggaggacgcagggtgc
gtggcgaacggcggcggcgagcggaaggacgggggggaggacgcgcaccgggagtacttg
cggtacttgcagcagacgggagaaggccgcgacggggtgcaggagctgctgttcgcgcgg
ccggcgggcaaggaccggcggctgctgccgttcggggacgggacgcccaaggtgtttgga
ttggagaactacggcaacacctgctactgcaactcggtgctgcagtgcctgtacaacctg
aaggagctgcgcgtgaacgtgttgaagtaccctacgcgcgcggagccgacagagcgcata
cgccggccggactccgggctcctgcggccgcgcgcggcgtcagattccggaccggccaca
actgctgtcggcggagagggcgagagcgcgcgtcgtgcgtcgattggagcgccggtgccg
tcgacaaagggactggtgcggcgccgctcgttgaatttcttcagcaggggtgcccaggcg
cgccgggggaaggatctgcagcagaacggcaccgctccagggctggagtcgcagcagaac
ggcggcaccaaacaggaaccggagcagaacggcgatacacagcagagttgtaacgatagc
gggaatgaattcatatacaaagaggccctggacgaggatggtacggctgcagacactaat
ggtgctacgctggcgttggaaaatgtcgcatcgcgggataacatggccgcggaccccatc
atggagatgatacatgaaggatacggcaaggtcattgttggtcgtttgcaaacaaagaat
gcgcagctgcagcgttcgttgacgacgctgacgacaatggtccactcggaaagccgcaac
ccgtctgcatcgtcatcgacctccactgcatcctctggaactgcggcaggctctggcgct
ctccggcagtctagctcacccgtttacgctagcaatatgtccagtgaacagcggaagaag
gctgcattgatcacgggtccggtgctatgcattgaccagccgatgcacagtaattacttc
cctagtgacatggagcccaccctatacaatgcattaaaagacgtgttcgagtgcattgcg
gagtctaaccacatgctaggggttgtctcgccgtcgcattttgttagcgttctgcgtaaa
gaaaacgttcttttcaatagcatgatgcaccaagatgcacatgaatttctaaactttcta
atgaatgccttgagtgattctctgcaactgcagctgcagcggttgccggataagtcacct
gaaaactttattcatactcttttccagggtaccatgaacaactccataaaatgtctgacc
tgtgataatattacctctaatgaggagcccttttttgactttgcaattcctgtgagtgag
gacgaagaggtgaatgtccaagacattctccgcgacttccaccagcgcgaaatgcttaac
ggcgcgaataagttttattgtgactcgtgcaatgggctacaggaggccgaacggaccgtt
ggcatcaaagaacttccggaactgctcccactccatctgaagcggtttaaatacagcgaa
aagcatcagtccaacatcaaactcttcaatgtaattcactatcctctgaatctcagggtg
tgttcaaccttcgaccacgccgtttgcaaagactacgaacttaacgggattgttatccat
atggggggcgggccgcaacatggacattatgtcgctatttgtaaacacgagctatttggg
tggcttctatacgatgatgagactgtcgagtcagtgggggaagatgcagtcttgaggttc
ataggggatgtgaacgatatgaccacagcctatgttttattctacaaatcgaaacgtgaa
gacgatgacaccccagccgaactacaggattataatgcgaacattgaccagctgctcaag
tacgacgactggatgcgccggaggagtgctagttctgctgtcccagtggcatcgtatgct
gctacgctcgaagaagttccggaagagaaggatagccattatataaggacgagtgataac
ggtacggtcaaacaaaaggcaaaaatgttcaggcttaaacgctcaaaggccagttgcaaa
taa

DBGET integrated database retrieval system