KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR389CHelp
Entry
AGOS_AGR389C      CDS       T00167                                 

Definition
(RefSeq) AGR389Cp
  KO
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AGOS_AGR389C
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AGOS_AGR389C
Ubiquitin system [BR:ago04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AGOS_AGR389C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(1761487..1763814)
Genome map
AA seq 775 aa AA seqDB search
MDFGLEQKLRDLGAICGTKNVQSTLYLVVLTTLLILYKQRKQVGNIMDGIGQVAGNFTRD
FRHRMLGRWAPQSAELEKQAHQHGGNVGGLVNDGNTCFINSVIQSLASSRELLRFLDEEI
IDASQPGTDESADDVQNGDEDEGSSSAKKKAYGKRKKKQARAADAVALAKADGPRTDFSA
ALRELIDNLNGKHYRNKPYFRTSGLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKD
VQSIQGKPEKNAKPVPKEELPGDAIIGSEHIGRIGTVYIPTEQIAPNSVLNDPERYYTPF
KLLTPFDGITAERVGCLQCGENGGIRYCLFSSLSLNLPNDNTSSTLKLSELLREWVKPEI
IEGVECNRCALQAVHAHLAAKVKELQAAEDEKAMSAKLISLMKARLEQLEGILAKPAIDD
EDYKKLHTDNMVRKCSKSKQTLITRPPPLLSIHINRSVFDPRTFMIRKNNSKVLFKSRLN
LAPWCCGVDEVNLDARLPMSKKDAAELEESSEDEPQGTEYYNKLHLRFQAEYEDEDDLDK
GPNPSGPHSSYRAVADVPNYDPLAGEYSSSSEEEHERESIELDALGNTIPKNGPASLEEL
SSDEDLATKPRAEILEKPDNDEDEEPSDDEDADDYDSDSPRPGDSGSELRDPPAPATFAT
ELHGSSVLASPLTYSLRSVIVHYGTHNYGHYIAFRKFRGVWWRISDETAYIVDEAEVLST
PGVFMLFYEYDYDEATGQLRDDLGCLQEPKVVLSDGDEEYDSLTGSTKTSINEQL
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggattttgggctagagcagaagctacgggatttgggggccatctgcgggacgaagaac
gttcagagcacgttatatctggttgtgctgacgacacttttgattctctacaagcagcgg
aagcaggtcggaaatatcatggacggcatcgggcaggtcgcggggaacttcacgcgcgac
tttcggcaccggatgctggggcggtgggcgccgcagagcgcggagctggagaagcaggcg
caccagcacggggggaacgtggggggtttagtgaacgacggtaacacgtgcttcatcaac
tcggtgatacagtcattagcgtcgtcgcgcgagttgttgaggtttttggacgaggagatt
atcgacgcaagtcagccgggcacggatgagagcgcggacgatgtgcagaacggggacgag
gacgaaggctcttcgagcgcgaagaagaaggcgtacggcaagcgcaagaagaagcaggcg
cgcgccgccgacgccgtagcgctggccaaggccgacgggccgcgtacggactttagtgcc
gctttgcgggagcttatcgacaacttgaacgggaagcactaccggaacaagccgtacttc
aggaccagcggtttgttgaagacgatgtccaaggcgcccaacaagaacattattcttggc
tacgaccaggaggatgcgcaggagtttttccagaccatcttatcggagcttgagaaagac
gtgcagtctatccaaggcaagcctgagaagaatgcgaagccggtaccaaaagaggaactc
cctggcgatgctattattggctcggaacatatagggcgcatcggaacagtctacattccg
actgagcagatagcgcccaacagcgttttgaatgaccccgagcgatactacacgccattt
aagcttctgacgccttttgatggaattaccgcggagcgtgttgggtgtttgcagtgcggc
gagaatggcggcattcgctactgtttgttttccagcttgtccttaaacttaccgaacgac
aacacaagctctacgttgaagttgtctgaattgttgcgtgagtgggttaagccagagatc
attgagggtgttgagtgtaaccgatgtgcactacaggcggtgcacgcccatttagccgcc
aaggtcaaggagctgcaggctgctgaggacgagaaggcgatgtctgctaagcttataagc
ctgatgaaggcgagattagaacaattggaggggatcctagcaaagccggccatcgacgat
gaagattacaagaaactacacacagataacatggtgcgtaagtgctcgaagtcgaagcag
accttgataacgcggccgccaccgttgttgtcgattcacatcaaccgttcggtcttcgat
ccccgcacgttcatgatccggaagaacaactccaaggtgctgttcaagtcaagactcaac
ttggctccatggtgctgtggcgtcgatgaggtgaacctagatgcgcgtctacccatgtcc
aagaaggacgcggctgagctcgaagagtcttctgaggacgagcctcagggaaccgaatac
tacaacaagctccacctcaggttccaagccgagtacgaggacgaagatgacctggataaa
ggacccaatccctcaggaccacattccagttaccgtgccgtcgcggacgtccccaattac
gatccgttagctggcgagtactcttcgtccagtgaggaggaacacgagagggagtcgatt
gaattggacgcgcttggcaacacgattccaaagaatgggccggcgtctttggaggaattg
tcctcggacgaagaccttgcaaccaagccgcgcgcggagatccttgagaagccagataac
gacgaggacgaggagcccagtgacgatgaggatgccgacgactacgactcggattctccc
cggcccggcgacagcggcagcgaactcagagaccctcctgcgccggcgacattcgctacg
gaactgcacggatccagcgtcctggcctccccgttgacctattccttgcgctccgtcatc
gtccactatggcacacacaactacggacactacattgccttccgcaagttccgtggtgtg
tggtggcgcatcagcgacgaaacagcgtacatcgtcgatgaagctgaggtcttgtccaca
ccgggcgttttcatgttgttctacgagtatgactatgacgaggcgaccgggcagttgcgt
gacgacttgggctgcctacaggagcccaaggtcgtgctgtcagatggggacgaggaatac
gactcattgaccgggtccaccaagacctcgatcaacgagcagctgtag

DBGET integrated database retrieval system