KEGG   Agrobacterium sp. H13-3: AGROH133_02861Help
Entry
AGROH133_02861    CDS       T01432                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:agr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:agr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:agr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48348..50516
Genome map
AA seq 722 aa AA seqDB search
MSRTNKFGLSIDDRLYAFLTDDVLPGTGFDAETFFEGFSAIVHELSPKNRELLEKRDALQ
EKLDGWYRQNGAPTDFDVYEGFLKEIGYLLPEGPGFKVETSNVDSEIAAVAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAISDADGAEKGRGYNPKRGEKVIAWARNFLNESAPL
ETAGWSDVTGFKIVDGLLQLAIGDSKTGLKDAEQFKGFTGDAEKPATILLGKNGLHTEIV
IDPSTEIGKGDKAGISDVILESALTTIMDCEDSVAAVDAEDKVLVYGNWLGLMRGDLTEK
VSKGGNTFTRSLNPDRYYTAPDGGALTLPGRSLMLVRNVGHLMTNPAILDKDGREVPEGI
MDAVVTALIALYDVGPSGRRQNSRAGSMYVVKPKMHGPEEVAFANEIFTRAEKLVGMAPN
TMKMGIMDEERRTTVNLKESIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQ
AAWIAAYENWNVDIGLECGLSGNAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSP
TAATLHATHYHKVDVAAVQDDLKSRGRAKLSDILSVPVVPRPNWTPEEIQRELDNNAQGI
LGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLRHGVVTQEQIVETMKRM
AAVVDSQNAGDPAYLPMASNFEGSVAFQAAVELVLKGREQPNGYTEPVLHRRRLELKAKQ
AA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaccaataaattcggtctttccattgatgacaggctttatgcttttttgacg
gatgacgttctaccgggcacgggttttgatgcagaaaccttcttcgaaggcttttccgcc
atcgtccacgagctttcccccaagaatcgtgaattgctcgaaaagcgcgacgccttgcag
gaaaaactggatggctggtaccggcagaatggcgccccgacggattttgatgtctatgag
ggcttcctgaaggaaatcggctatctgctgccggaaggtcccggcttcaaggtcgaaacc
agcaacgtcgattcggaaattgccgctgtcgcaggcccgcagcttgtcgtgccggtcatg
aatgcccgttatgcgctgaacgccgccaatgcccgctggggttcgctttacgatgcgctt
tacggcacggatgccatttctgacgccgatggtgcggaaaagggcaggggctataatccg
aaacgcggcgaaaaggtcattgcctgggcgcggaacttcctcaacgaatcagctccgctc
gaaacggcaggctggtcggatgtgaccggcttcaagatcgttgacggcctcttgcagctt
gcaatcggtgacagcaaaacgggcctgaaagatgccgagcaattcaagggctttaccggc
gatgcggaaaagccggcaacgatcctgcttggcaagaatggtctgcacaccgagatcgtc
atcgatccctcgacggaaatcggcaagggtgacaaggcgggcatctcggatgtcattctc
gaatcggcgctgacaaccatcatggactgcgaggattccgttgccgctgttgatgccgag
gacaaggtgctggtttatggcaactggcttggcctgatgcgcggcgacctgacggagaag
gtttccaagggtggtaacaccttcacccgtagtctcaacccggatcgttattacaccgcc
cccgatggtggagcacttactctgccggggcgctccctgatgctggtgcgtaatgtcggt
cacctcatgaccaatccggcgatccttgacaaggatggccgcgaggtgccggaaggtatc
atggacgccgtcgtcacagcgctgattgcgctttacgatgtcggcccctccggccgtcgc
cagaattcccgtgccggttccatgtatgtcgtcaagccgaagatgcacgggccggaggaa
gtcgccttcgccaacgagattttcacgcgtgccgaaaagcttgtcggcatggcgccgaac
accatgaaaatgggcatcatggacgaggaacgccgcaccacggtcaacctcaaggaaagc
attcgcgcggcaaaagaccgggtcgtcttcatcaataccggcttcctcgaccgcacgggc
gacgaaattcatacctcgatggaagcgggtccgatgatccgcaagggcgatatgaaacag
gcggcctggattgcggcttacgagaactggaacgtcgatatcggtctggaatgcggcctt
tccggcaatgcgcagatcggtaagggcatgtgggccatgcctgacctgatggccgccatg
ctggagcagaagatcgcgcatccgaaggcaggcgccaacaccgcctgggtaccttcaccc
acggctgcgacgctgcatgccacgcattatcacaaggtcgatgtcgcagccgttcaggac
gacctgaaaagccggggccgggcaaaactctccgatattctatcggtgccggtcgtgccg
cgtcccaattggacgcccgaggaaatccagcgcgaactcgacaacaacgcgcagggtatt
ctgggatatgtcgtgcgctgggtcgatcagggcgtcggctgctccaaggtgcctgatatc
aacaatgtcggactgatggaggaccgcgccacgctgcgcatctccgcgcagcatatggcc
aactggctgcgccatggcgtggttacgcaagagcagatcgttgagaccatgaaacgcatg
gccgccgtggtcgatagccaaaatgccggagatccggcctatctgccgatggcgtccaac
tttgaaggatcggtcgcttttcaggccgccgtcgaacttgtgctgaaaggccgggagcag
cctaacggttatacggaaccggttctgcaccgccgtcgcctcgaactgaaggcgaagcag
gcggcttga

DBGET integrated database retrieval system