KEGG   Agrobacterium sp. H13-3: AGROH133_02943Help
Entry
AGROH133_02943    CDS       T01432                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
agr  Agrobacterium sp. H13-3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:agr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AGROH133_02943 (recR)
DNA repair and recombination proteins [BR:agr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AGROH133_02943 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97626..98231)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKEQLLGPLGHAMGEAYDKVKIC
SCCGNVDTIDPCTVCADDRRDQSVIIVVEDVSDLWALERAGAMNTAYHVLGGTLSPLDGV
GPEDLNIKGLIDRVSAGGIRELIIAVNATVEGQATAHYITDHLADLGIKITRLAHGVPVG
GELDYLDEGTLTAALRARTTI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggtcccgaaatcgaaaaactgatccagctgcttgcaaaagta
ccggggcttgggcctcgctcggcgcggcgggcggcgctgcatctcatcaagaagaaggaa
cagcttcttggaccgctgggccacgcgatgggtgaagcctatgacaaggtgaagatctgc
tcgtgctgcggcaatgtcgataccatcgatccctgcacggtctgcgccgatgatagacgt
gaccagtcggtcatcatcgtggtggaagacgtgtcggatctgtgggcgctggagcgagca
ggcgccatgaataccgcctatcatgtgcttggtggcacgctgtcgccgctcgatggcgtc
gggccggaagatctgaacatcaagggactgatcgatcgcgtcagcgccggcggtattcgc
gagctcatcatcgccgtcaatgcgacggtggagggacaggcaacagcccattacatcacc
gaccacctggccgatctcggcatcaagatcacccggcttgcgcatggcgtgcctgttggc
ggcgagctggactatctcgatgagggcacattgacggcggcgctgcgcgctcgcacaacg
atctga

DBGET integrated database retrieval system