KEGG   Agrobacterium sp. H13-3: AGROH133_02951Help
Entry
AGROH133_02951    CDS       T01432                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
agr  Agrobacterium sp. H13-3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:agr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:agr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104670..105242
Genome map
AA seq 190 aa AA seqDB search
MNSYVNMGVGALLGTVFVLMSVSIASEGIFHAPTPEKEGYAIVAEASGGEAAGEPAAAAT
PIAKLLASADAAKGEAVFKKCTSCHTGESGGANKVGPNLFDIVNRPIASHAGFSYSAAMK
DFSKGGSVHWDYDHLSYFIEAPKKHVPGTAMGFAGVKKETERADLIAYLRTLSANPAPLP
DPAAAPVPIN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttatgtaaatatgggcgttggggcgttgctgggcacggttttcgttctgatg
tcggtgtcaattgcgtctgagggcatttttcatgcgcccaccccggaaaaggaaggttac
gccatcgtcgcggaagcgagcggcggcgaggctgcaggcgaacccgctgcagccgcaacc
ccgatcgcgaaattgctcgccagcgcggatgctgccaagggtgaggcggtcttcaagaag
tgtacgagctgtcataccggagagagtggtggtgcaaacaaggtcggccccaatctcttc
gatatcgtcaaccggccgatcgccagccatgcgggtttcagctactccgcagcaatgaag
gatttctccaagggcggttccgtgcactgggattacgatcatctcagctacttcatcgaa
gctcccaagaaacacgttcccggcacggccatgggctttgcgggtgtgaagaaggagacg
gaacgcgccgatctcatcgcttatctgcgcacgctgtcggcaaacccggcgccgctgccg
gatccggctgcggctcccgtgccgataaactga

DBGET integrated database retrieval system