KEGG   Agrobacterium sp. H13-3: AGROH133_03162Help
Entry
AGROH133_03162    CDS       T01432                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00010  Glycolysis / Gluconeogenesis
agr00052  Galactose metabolism
agr00500  Starch and sucrose metabolism
agr00520  Amino sugar and nucleotide sugar metabolism
agr00521  Streptomycin biosynthesis
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
Module
agr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_03162 (glk)
   00052 Galactose metabolism
    AGROH133_03162 (glk)
   00500 Starch and sucrose metabolism
    AGROH133_03162 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AGROH133_03162 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AGROH133_03162 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AGROH133_03162 (glk)
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AGROH133_03162 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADY63169
UniProt: F0L4A2
Position
circular:complement(186320..187354)
Genome map
AA seq 344 aa AA seqDB search
MEQVMPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTAEYPTIDDAIQQ
AVLDKTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKDVIVINDFEAQAL
AIAALDDDNRDSIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFPVPGEGGHIDIGPR
SARDYAVFPHIETIEGRIAGEQILCGRGLVNLYRAICTADGIEPIFSDPADITSQGLSGQ
NPQAKETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIVPALKSPEFRAAFEDKAP
HSALMRSIPTFVVTHPQAALSGLATYARTPSDFGLSLDGRRWRA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggtaatgccgaagacgtccgataccgaatatctttcctttccgatccttctt
ggcgacatcggcggcaccaatgcccgcttttccattctgatcgattcctttgcggaaccg
gtgcacctcaccaccgtgaaaacagcggaatatccgacaattgacgacgccatccagcag
gcggttctggacaagacctcgcttcagcccgtgtcgaccatccttgcgatcgccggcccc
atcgaaggcgacgagattccgctgaccaactgccattgggtcgttaagccgaaggatatg
ctggccaaactcggcctgaaggacgtcatcgtcatcaacgatttcgaggcgcaggcactg
gctattgccgcgctcgacgacgacaaccgcgattctatcggctccggcaaaaaagacatg
ctggcatcgcgcgtcgttctcggaccaggcacaggccttggcgttgccggtctggtttac
gcccggcatatgtggtttcccgtacccggcgaaggcggccacatcgatatcggccccaga
agcgcgcgtgactatgcggtctttccgcatatcgagaccatcgagggccgtatcgccggc
gaacagatcctttgcgggcgcgggctggtcaatctttaccgggccatctgcaccgccgat
ggcatcgagccgatcttttccgatccggccgacataacctcgcaggggctttcgggccag
aacccgcaggcgaaagagacgctttcgcttttcagcacctatctcggccgtgtggcgggt
gaccttgccctgatcttcatggccaagggcggtgtctatctcgcaggtggcatttcgcag
aaaatcgttcccgcgctgaaaagccctgaattccgggcggcgttcgaagacaaggcgccg
cacagtgccctgatgcgcagcattcccaccttcgtcgttacccatccacaggcggccctt
tccggtctcgccacctacgcgcgcaccccttcggatttcggcctttcactcgacgggcgg
cgctggagagcctga

DBGET integrated database retrieval system