KEGG   Agrobacterium sp. H13-3: AGROH133_03485Help
Entry
AGROH133_03485    CDS       T01432                                 

Gene name
fadB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AGROH133_03485 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AGROH133_03485 (fadB)
   00650 Butanoate metabolism
    AGROH133_03485 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_03485 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AGROH133_03485 (fadB)
   00310 Lysine degradation
    AGROH133_03485 (fadB)
   00360 Phenylalanine metabolism
    AGROH133_03485 (fadB)
   00380 Tryptophan metabolism
    AGROH133_03485 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGROH133_03485 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AGROH133_03485 (fadB)
   00281 Geraniol degradation
    AGROH133_03485 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AGROH133_03485 (fadB)
   00627 Aminobenzoate degradation
    AGROH133_03485 (fadB)
   00930 Caprolactam degradation
    AGROH133_03485 (fadB)
Enzymes [BR:agr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AGROH133_03485 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311260..312033
Genome map
AA seq 257 aa AA seqDB search
MDYETILVEKRDEVGVITLNRPKALNALNSVLLKELRHILSSFSADDSIGAIIITGSEKA
FAAGADIKEMQGLDFVDAYVGDFLGGWDEVASTRKPVIAAVSGFALGGGCELAMMCDFII
ASDTAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERAGLVSRIV
PAANLMDEAVDAATRIASLSRASVLMAKESVNRSFEVPLSEGLRYERRSFQSLFATADQK
EGMAAFVEKRKPAFRNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggattatgaaacgatactggtcgagaaacgcgacgaggtgggcgtcatcacgctaaac
cggcccaaggcgctcaacgccctcaattcggtgcttctgaaggaacttcggcacattctc
tcctcgttctctgctgacgattccatcggcgcgatcattataacggggtcggaaaaggca
tttgccgccggcgcggacatcaaggaaatgcaggggctggattttgtcgatgcctatgtc
ggcgactttctcggcggctgggacgaggtcgcatcgacccgcaagccggtcattgccgca
gtctccggctttgcgctgggcggcgggtgtgagctggcaatgatgtgcgatttcatcatc
gcttcggacacggcgaaattcggtcagccggaaatcacgcttggcgtcattcccggcatg
ggcggctcgcagcggctgacgcgggcggtgggcaaggcgaaggccatggatctggttctg
accggccgcatgatggatgcggccgaggcagagcgcgccggcctcgtttcgcggatcgtc
ccagcggcgaatctcatggatgaggcggtggatgccgccacgcgcatcgcctcgctgtct
cgcgcttccgttctcatggccaaggaaagcgtcaatcgctccttcgaggttcctctttcg
gaagggctgagatatgaaaggcgatcctttcagtcgctctttgcaacagcggatcagaag
gagggcatggcggccttcgttgaaaagcgcaaacccgctttccggaatcgctaa

DBGET integrated database retrieval system