KEGG   Agrobacterium sp. H13-3: AGROH133_03574Help
Entry
AGROH133_03574    CDS       T01432                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00300  Lysine biosynthesis
agr01100  Metabolic pathways
agr01120  Microbial metabolism in diverse environments
agr01230  Biosynthesis of amino acids
Module
agr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AGROH133_03574 (dapE)
Enzymes [BR:agr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AGROH133_03574 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADY63348
UniProt: F0L5G6
Position
circular:complement(359426..360622)
Genome map
AA seq 398 aa AA seqDB search
MTTTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVEKMVATEAGTPDVENLYAR
LGTEGPHLMLAGHTDVVPVGDEAAWSHPPFAAEIAGGEMFGRGAVDMKGGIACFVAAIAR
YIEKHGKPKGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWDACVVGEPTNPDQLGEMI
KIGRRGSISGRITVHGVQGHAAYPHLADNPIRGLLQLTHALMYPPFDHGTDDFQPSNLEV
TTIDTGNAATNVIPARATASFNIRFNDSWTVESLRAEIIRRLDAAAAEGELRPDRSPVKY
EIVWADRPAHVFLTRNNALISSLSGAVEAVTGKEPKLSTTGGTSDARFIKDYCPVVEFGL
VGQTMHMVDERVEIADLETLTRIYETFIERWFSHADGK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccgatcccgttgcaaatctcgccgccctcatccgttgcccttcggtgacg
cccgccgaaggtggcgcgctatcgctgctagacaccctgctttcaccgcttggctttgcg
gtggaaaagatggtggcgacggaagcgggaacgcctgacgttgaaaacctctacgcccgg
cttggcacggaaggcccgcacctgatgcttgcgggccataccgatgtcgttccggtgggc
gacgaggcggcatggagccatccgccctttgccgctgaaattgccggcggcgaaatgttc
ggccgtggtgcggtggacatgaagggcggcattgcctgtttcgttgctgccattgcccgc
tacatcgagaaacacggaaaaccgaaaggttccgtttctttcctgatcaccggtgacgag
gaaggcccctcgatcaacggcacctccaagttgctggaatgggccgccgccaaaggcgag
acatgggatgcctgcgtggttggtgaaccgaccaaccccgaccagctgggcgaaatgatc
aagatcggccgccgggggtcgatttcgggccgcatcaccgtgcatggcgtgcagggtcat
gccgcatatccgcatctggccgacaaccccattcgcgggctgctgcaactgacccacgcg
ctgatgtatccgcccttcgatcacggcactgacgacttccagccgtccaatctggaagtg
acgaccatcgacaccggcaatgccgccacaaatgtcattccggcacgggcgacggcgtcg
ttcaacatccgtttcaatgacagctggacggtggagagcctgcgggcggaaatcatccgc
cgcctcgatgccgccgctgccgagggagaacttcgtcccgaccgcagcccggtcaaatat
gagatcgtctgggcggaccgtccggcccatgttttcctgacccggaacaatgcgctcatc
tcatcgctttccggcgccgtggaagccgtgacaggcaaggagcccaagctttcgaccacc
ggcggcacgtctgatgcgcgtttcatcaaggattattgccccgtcgtggaattcggcctc
gtcgggcagaccatgcatatggtcgatgagcgcgtggaaatcgccgatctggagacgctg
acacgcatctacgagaccttcatcgaacgctggttctcccatgccgacggcaagtga

DBGET integrated database retrieval system