KEGG   Agrobacterium sp. H13-3: AGROH133_03803Help
Entry
AGROH133_03803    CDS       T01432                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00071  Fatty acid degradation
agr00072  Synthesis and degradation of ketone bodies
agr00280  Valine, leucine and isoleucine degradation
agr00310  Lysine degradation
agr00362  Benzoate degradation
agr00380  Tryptophan metabolism
agr00620  Pyruvate metabolism
agr00630  Glyoxylate and dicarboxylate metabolism
agr00640  Propanoate metabolism
agr00650  Butanoate metabolism
agr00900  Terpenoid backbone biosynthesis
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
agr01212  Fatty acid metabolism
agr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AGROH133_03803 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    AGROH133_03803 (fadA)
   00640 Propanoate metabolism
    AGROH133_03803 (fadA)
   00650 Butanoate metabolism
    AGROH133_03803 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_03803 (fadA)
   00072 Synthesis and degradation of ketone bodies
    AGROH133_03803 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AGROH133_03803 (fadA)
   00310 Lysine degradation
    AGROH133_03803 (fadA)
   00380 Tryptophan metabolism
    AGROH133_03803 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AGROH133_03803 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AGROH133_03803 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AGROH133_03803 (fadA)
Enzymes [BR:agr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AGROH133_03803 (fadA)
Exosome [BR:agr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGROH133_03803 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: ADY63437
UniProt: F0L5Y4
Position
circular:454877..456085
Genome map
AA seq 402 aa AA seqDB search
MTDVYIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNGLDTSAVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSNKAPGMQISRFCASGLDAINFAAGKVKAGSDDIVIAGGVES
MSRVGMGMSGGAWYMDPSVNFPAFFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHA
WEKGYFNKSVIPVKDRNGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIMA
HPEVERINYVHHAGNSSGIVDGAAAVLVGSKAGGEAMGVKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKKTGMSLADIDLFELNEAFAAVVLRYMQAFDISHERMNVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtttacatttatgaccatgtccgcaccccgcgcggacgcggcaagaaggat
ggcagcctgcatgaggtgccctccgttcgccttgccgccaagacgctggaagccatccgc
gaccgcaacgggctcgatacgtctgctgtcgatgacatcatcatgggctgtgtcgatccc
gtcatggatgccggtgcagttatcccgaaagccgccgccttcgaggccggttattccaac
aaggcaccgggaatgcagatctcgcgcttctgcgcttcaggtctcgatgccatcaacttc
gcggccggcaaggtcaaggcaggctccgacgatatcgtcatcgccggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtctggtggcgcctggtacatggacccttcggtcaac
ttccccgccttcttcatgccgcagggcgtatcggcagatctcatcgccaccaaatacggt
ttttcccgtgacgatgtcgacgcctatgctgtcgaaagccagaagcgcgccgcgcatgcc
tgggaaaagggctatttcaacaagtccgttatccccgtgaaggaccgcaacggcctgacg
atcctcgaccgcgacgaacatatgcgccccggtacggacatgcaggcgctggcttccctc
aacccctctttccagatgccgggtgaaatgggcggcttcgaagccgttggcatcatggcg
cacccggaagtggagcgtatcaactacgtgcaccatgcgggcaattcgtccggtatcgtc
gatggcgcggccgccgttctggttggttccaaggcgggcggcgaggcgatgggcgtgaag
ccgcgtgcccgcatcagggctttcgccaatatcggttccgatccggcgctgatgctgacc
ggcccggtggatgtgaccgagaagcttctgaaaaagaccgggatgtcgcttgccgatatc
gatcttttcgaactcaacgaggccttcgccgccgtcgtgctgcgttacatgcaggccttc
gacatcagccacgagaggatgaacgtcaatggcggcgcaatcgccatgggccatccgctg
ggtgcgacaggagcgatgatcctcggcacggtgcttgacgagttggagcggcgcgatctg
aacaccgcgctcgtcacgctctgcatcggcgcgggcatgggcacagcgaccgttatcgag
cgggtttga

DBGET integrated database retrieval system