KEGG   Agrobacterium sp. H13-3: AGROH133_04112Help
Entry
AGROH133_04112    CDS       T01432                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AGROH133_04112 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_04112 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_04112 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AGROH133_04112 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AGROH133_04112 (adhP)
   00626 Naphthalene degradation
    AGROH133_04112 (adhP)
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AGROH133_04112 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576706..577734
Genome map
AA seq 342 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIEEVAIPDPGPGEILINYKATGICHTDLHAATGDWPVKPNPP
FIPGHEGVGYVAKIGAGVTGIKEGDRAGTPWLYTACGCCIPCRTGWETLCPSQKNSGYSV
NGSFAEYGLADPKFVGRLPDNLEFGPAAPVLCAGVTVYKGLKETEVRPGEWVVISGIGGL
GHMAVQYAKAMGMHVVAADIYDDKLELAKKLGADFTVNGRAPDAVEQVQKATGGVHGALV
TAVSPKAMEQAYGFLRSKGTMALVGLPPGFISIPVFETVLKRITVRGSIVGTRQDLEEAL
SFAGEGKVAAHFSWDKLENINDIFRRMEEGKIDGRIVVDLAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacaatgaaggccgcggttgtccgcgcatttggcaaaccgctgaccatcgag
gaagtggcgataccggatcccggcccgggtgaaattctcatcaattacaaggcgaccggc
atttgccacactgacctgcacgccgcaacgggcgactggccggtcaaacccaatccacca
ttcatccccggccatgaaggcgtcggctacgtcgccaagatcggcgctggcgtgaccggc
atcaaggaaggcgaccgcgccggcacgccgtggctttacaccgcctgcggatgctgcatt
ccgtgccgtaccggctgggaaactctttgcccaagtcagaagaactcgggttattccgtc
aatggcagctttgcggaatacgggcttgccgatccgaaattcgttggccgacttcccgac
aatctggaattcggtcccgctgcacccgtgctctgcgccggtgtcaccgtctacaagggt
ctcaaggaaaccgaagtgaggcccggcgaatgggtggtcatttcgggcattggcgggctt
ggtcatatggccgtgcaatatgccaaggccatgggcatgcatgtcgttgccgccgatatt
tatgacgacaagctggagcttgcgaaaaagctgggcgcggatttcaccgtcaacggtcgg
gcgccggatgcggtggaacaggtgcagaaggcgaccggcggcgtccacggcgcgctcgtg
acggcggtttcgcccaaagccatggagcaggcctacggtttcctgcgctccaagggcacg
atggcacttgttggcctgccgccgggcttcatctccattccggttttcgaaacggtgctg
aagcgcatcacggtgcgtgggtccatcgtcggcacaaggcaggatctggaggaggcgctt
tccttcgctggtgaaggcaaggtagccgcccacttctcctgggacaaactcgaaaacatc
aacgacatcttccgtcgcatggaagagggcaagatcgacggccgtatcgtcgtggacctt
gccgcctga

DBGET integrated database retrieval system