KEGG   Agrobacterium sp. H13-3: AGROH133_04112Help
Entry
AGROH133_04112    CDS       T01432                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00010  Glycolysis / Gluconeogenesis
agr00071  Fatty acid degradation
agr00350  Tyrosine metabolism
agr00625  Chloroalkane and chloroalkene degradation
agr00626  Naphthalene degradation
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_04112 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_04112 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AGROH133_04112 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AGROH133_04112 (adhP)
   00626 Naphthalene degradation
    AGROH133_04112 (adhP)
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AGROH133_04112 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: ADY63555
UniProt: F0L6Q8
Position
circular:576706..577734
Genome map
AA seq 342 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIEEVAIPDPGPGEILINYKATGICHTDLHAATGDWPVKPNPP
FIPGHEGVGYVAKIGAGVTGIKEGDRAGTPWLYTACGCCIPCRTGWETLCPSQKNSGYSV
NGSFAEYGLADPKFVGRLPDNLEFGPAAPVLCAGVTVYKGLKETEVRPGEWVVISGIGGL
GHMAVQYAKAMGMHVVAADIYDDKLELAKKLGADFTVNGRAPDAVEQVQKATGGVHGALV
TAVSPKAMEQAYGFLRSKGTMALVGLPPGFISIPVFETVLKRITVRGSIVGTRQDLEEAL
SFAGEGKVAAHFSWDKLENINDIFRRMEEGKIDGRIVVDLAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacaatgaaggccgcggttgtccgcgcatttggcaaaccgctgaccatcgag
gaagtggcgataccggatcccggcccgggtgaaattctcatcaattacaaggcgaccggc
atttgccacactgacctgcacgccgcaacgggcgactggccggtcaaacccaatccacca
ttcatccccggccatgaaggcgtcggctacgtcgccaagatcggcgctggcgtgaccggc
atcaaggaaggcgaccgcgccggcacgccgtggctttacaccgcctgcggatgctgcatt
ccgtgccgtaccggctgggaaactctttgcccaagtcagaagaactcgggttattccgtc
aatggcagctttgcggaatacgggcttgccgatccgaaattcgttggccgacttcccgac
aatctggaattcggtcccgctgcacccgtgctctgcgccggtgtcaccgtctacaagggt
ctcaaggaaaccgaagtgaggcccggcgaatgggtggtcatttcgggcattggcgggctt
ggtcatatggccgtgcaatatgccaaggccatgggcatgcatgtcgttgccgccgatatt
tatgacgacaagctggagcttgcgaaaaagctgggcgcggatttcaccgtcaacggtcgg
gcgccggatgcggtggaacaggtgcagaaggcgaccggcggcgtccacggcgcgctcgtg
acggcggtttcgcccaaagccatggagcaggcctacggtttcctgcgctccaagggcacg
atggcacttgttggcctgccgccgggcttcatctccattccggttttcgaaacggtgctg
aagcgcatcacggtgcgtgggtccatcgtcggcacaaggcaggatctggaggaggcgctt
tccttcgctggtgaaggcaaggtagccgcccacttctcctgggacaaactcgaaaacatc
aacgacatcttccgtcgcatggaagagggcaagatcgacggccgtatcgtcgtggacctt
gccgcctga

DBGET integrated database retrieval system