KEGG   Agrobacterium sp. H13-3: AGROH133_05246Help
Entry
AGROH133_05246    CDS       T01432                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:agr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:agr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:agr03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:agr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:agr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052355..1052804
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLEKSLERGWKVAIQTVDEERRDFLDTHLWTFRDDSFLPH
ATDTSAAPQNQPILLTASNANGNEASVRFLVDGAEPPAVEGYERIVFMFDGYDAYQLEMA
RNHWKRLKTEGHALTYWQQSPEGRWQKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatcctgttctaccatctgacggaatcgaagctggaggatgcattgccgccc
ttgctcgaaaaatcgctggaacgcggctggaaggtcgcgatccagacggtggacgaggag
cgccgcgatttcctcgacacgcatctgtggacctttcgtgacgacagttttctgccgcac
gcaacggatacctctgccgcgccgcaaaaccagccgattcttttgacggcgtcgaatgcg
aacggtaacgaggcgagtgtccgctttctggtcgacggtgccgaaccgccggcggtggag
ggctatgagcggatagtgttcatgttcgacggatatgatgcctaccagctggaaatggca
cggaaccactggaaaaggctgaagaccgaaggtcatgcgctgacctattggcagcagtcg
ccggaaggccgctggcagaagaaggcctga

DBGET integrated database retrieval system