KEGG   Agrobacterium sp. H13-3: AGROH133_05806Help
Entry
AGROH133_05806    CDS       T01432                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AGROH133_05806 (folK)
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AGROH133_05806 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1284338..1284838
Genome map
AA seq 166 aa AA seqDB search
MGLGGNIGDPAAAMARALRELDAHGDCRVLSVSGLYRTPPWGKTDQADFFNCCALVETSL
SAPALLQLCLDIEKGMKRVRTERWGPRTIDIDVLTYGNDVVVTESIEVPHPRMTERAFVL
MPLADIAPDLEVRGKPVREWLRQADKTGIISANEKREWWTLPLGDG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ctgggccttggcgggaatatcggtgaccccgccgctgcgatggccagagccttgcgcgaa
ctggatgcacacggcgattgccgggtgctgtctgtctccgggctttaccgcacgccgccc
tggggtaagacggaccaggcggattttttcaattgctgtgcgctggtcgaaacctcgctt
tcagcacccgcgctgctgcaattgtgcctcgatatcgaaaagggcatgaaacgggtcaga
acggagcgctgggggccacgcaccatcgatatcgacgtgctgacctatggtaatgatgtt
gtcgttacggaaagcattgaagtgccgcatccgcgcatgacggagcgtgctttcgtgctg
atgccgctagccgatatcgcacccgatctcgaagtccggggcaagcccgtgcgggaatgg
cttcggcaggcggataaaaccggcatcatcagcgcaaacgaaaaacgggagtggtggaca
ctcccgcttggcgatggctga

DBGET integrated database retrieval system