KEGG   Agrobacterium sp. H13-3: AGROH133_05922Help
Entry
AGROH133_05922    CDS       T01432                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00010  Glycolysis / Gluconeogenesis
agr00020  Citrate cycle (TCA cycle)
agr00620  Pyruvate metabolism
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
Module
agr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_05922 (aceF)
   00020 Citrate cycle (TCA cycle)
    AGROH133_05922 (aceF)
   00620 Pyruvate metabolism
    AGROH133_05922 (aceF)
Enzymes [BR:agr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AGROH133_05922 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ADY64306
UniProt: F0L387
Position
circular:1332845..1334215
Genome map
AA seq 456 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEAVKVNALIAILAADGEDVAEAAKGGNAAPAASQAKAEAPKQEAAKAEAPKEEAV
PAKAEKPAADQASAPSTPAPVAKSGERIFASPLARRLAKEAGLDLTAVSGSGPHGRIVKT
DVEKAAASGGAKAAPAAAASAGAPAAALAKGPSEEAVLKLFEPGSYELVPHDGMRKVIAK
RLVESKQTVPHFYVSVDCELDTLLALRAQLNAAAPEKDGKPAYKLSVNDMVIKALALALR
DVPDANVSWTESNMVKHKHSDVGVAVSIPGGLITPIIRKAEEKSLSTISNEMKDYGKRAK
ERKLKPEEYQGGTTAVSNMGMMGVKSFSAVINPPHATILAVGAGEQRAVVKNGEIKIANV
MTVTLSTDHRCVDGALGAELIGAFKRYIENPMGMLV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccgataaacatcaccatgcctgccctttctccgacgatggaagagggtaatctggcc
aagtggctggtcaaggaaggcgacaaggtcgcacccggtgacgtgatcgccgagatcgag
accgacaaggcaaccatggaagtggaagccgtcgatgagggcacggtcgccaagctcgtg
gttcccgcaggcacggaagcggtcaaggtcaacgccctgatcgctatcctcgccgccgat
ggcgaggatgtggctgaggcagcaaagggcggcaatgctgctcctgccgcgtcccaggcc
aaagccgaggctccgaagcaggaagctgcaaaggccgaagcgccaaaggaagaggctgtc
ccggccaaggctgaaaagccagctgccgaccaggcctccgcaccttccaccccggccccg
gttgcaaaatccggcgagcgcatcttcgcttcgccgcttgcccgtcgtctcgccaaggaa
gccggtctcgacctcacggccgtgtccggttccggcccgcatggccgcatcgtcaagact
gacgtggaaaaggccgccgcttccggtggtgcgaaggcagctcctgccgccgcagcatcc
gcaggcgcaccggctgccgcacttgccaagggcccgtccgaagaagctgttctcaagctg
ttcgaacccggttcttacgaactggtgccgcatgacggcatgcgcaaggtcatcgccaag
cgtctggtcgaatccaagcagaccgttccgcatttctacgtttcggtggattgcgaactg
gatacgcttctggcgctgcgcgcccagctcaacgccgccgctcccgaaaaggacggcaag
cccgcctacaagctttcggtcaacgacatggtcatcaaggcgctggctctcgcgctgcgc
gatgtgcctgatgccaacgtctcctggacggaaagcaacatggtcaagcacaagcattcg
gatgtcggcgttgccgtttccattccgggtggcctgatcacgccgatcatccgcaaggcg
gaagagaagtcgctctccaccatctccaacgagatgaaggactacggcaagcgcgccaag
gagcgcaagctgaagcccgaggagtatcagggcggcacgacggccgtgtccaacatgggc
atgatgggcgtcaagagcttctccgccgtcatcaacccgccgcacgccaccattctggca
gtcggcgcgggcgaacagcgtgctgtcgtgaagaacggcgagatcaagatcgccaatgtc
atgacggttacgctctctaccgaccaccgttgcgtcgatggcgcgctcggagccgagctg
atcggtgccttcaagcgctacatcgaaaacccgatgggcatgctggtttga

DBGET integrated database retrieval system