KEGG   Agrobacterium sp. H13-3: AGROH133_06055Help
Entry
AGROH133_06055    CDS       T01432                                 

Gene name
cy2
Definition
Cytochrome c2
Orthology
K08738  
cytochrome c
Organism
agr  Agrobacterium sp. H13-3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AGROH133_06055 (cy2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AGROH133_06055 (cy2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1398320..1398715)
Genome map
AA seq 131 aa AA seqDB search
MRKRMIITAAMLAASAIPAFSEGDVAKGEAAFKRCSACHAIGEGAKNKVGPQLNGIIGRT
AGGDPDYNYSNAMKKAGGEGLVWTPEELRDFLSAPKKKIPGNKMALAGISKPEELDNLIA
YIESASSKPAE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagagaatgatcatcacggcggcaatgctcgcagcaagcgccattcccgctttt
tcagagggcgatgttgccaagggggaggcggcattcaagcgctgttccgcctgtcacgcc
atcggcgagggcgcgaaaaacaaggtcggcccgcagcttaacgggatcatcggccgcact
gcgggcggcgatccggactataattactcgaatgcgatgaaaaaagcaggcggggaaggg
ctggtgtggacaccggaggaactgcgagactttctcagcgctcccaagaagaaaatcccc
ggaaacaagatggccttggcgggcatcagcaaaccggaagaactggataatcttatcgcc
tacatcgaaagcgcgtcttcgaaaccagccgaatga

DBGET integrated database retrieval system