KEGG   Agrobacterium sp. H13-3: AGROH133_06354Help
Entry
AGROH133_06354    CDS       T01432                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:agr01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:agr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:agr00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518794..1520056
Genome map
AA seq 420 aa AA seqDB search
MSFDDILSAEERAGIGVQPKEEMDMSKNRGVVYLRPGQVEVRDIDDPKLEAPDGRRIEHG
VILKVISTNICGSDQHMVRGRTSAMPGLVLGHEITGEVIEKGVDVEMLDIGDIVSVPFNV
ACGRCRCCKSQDTGVCLTVNPARAGGAYGYVDMGGWIGGQARYVTIPYADFNLLKFPDRD
RAMSKIRDLTMLSDILPTGFHGAVKAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMI
GDFNKDRLAHAAKVGFEPVDLSKGDRLGDMIAEIVGTNEVDSAIDAVGFEARGHSGGEQP
AIVLNQMMEITRAAGSIGIPGLYVTEDPGAVDAAAKQGSLSLRFGLGWAKAQSFHTGQTP
VLKYNRQLMQSILHDRLPIADIVNAKIIALDDAVQGYESFDQGAATKFVLDPHGDLLKSA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgacgatatcctgtccgcggaggagcgggccggtattggtgttcaacccaag
gaggagatggatatgagcaaaaacagaggcgtcgtctatttgcgccccggccaggtcgag
gtccgcgacatcgatgatccgaagctggaggcgccggatggccgccgtatcgagcacggt
gtcattctcaaggttatttccacgaatatctgcggttcggaccagcatatggtgcgcggc
cgcacctcggcgatgcccggcctcgtccttggccatgagatcaccggcgaagtcattgaa
aaaggcgtcgacgtcgagatgcttgatatcggcgatatcgtctcggtgccgttcaacgtc
gcctgcggtcgctgccgctgctgcaagtcgcaggataccggcgtgtgcctgacggtgaac
cccgcccgtgccggcggcgcctacggttatgttgatatgggcggctggatcggcggacag
gccagatacgtcaccattccctatgccgacttcaaccttctgaaatttcccgaccgcgac
agggcaatgtccaagatccgcgaccttaccatgctctcggacatcctgccgaccggcttt
catggcgcggtcaaggccggcgtcggtgtcggctccacggtctatgtcgcgggcgccggt
ccggtcggtctggcggctgccgcatctgcccgtattctcggtgccgccgtcgtcatgatc
ggtgatttcaacaaggatcgccttgcgcacgccgccaaggtcggcttcgagcccgtcgat
ctttccaagggcgaccggctgggcgacatgattgccgagatcgtcggcaccaacgaggtc
gacagcgccatcgatgccgtcggtttcgaagcgcgtggccattcgggcggcgaacagccg
gccatcgttcttaaccagatgatggaaatcacccgtgccgccggctcgatcggcattccc
ggcctttacgtcaccgaagacccaggtgcggtcgatgccgcagcaaaacagggcagcctg
tcgcttcgcttcggtctcggttgggccaaggcacaatctttccataccggccagacgccg
gtgctgaaatacaatcgccagctcatgcagtcgatcctgcacgaccgcctgcccattgcc
gacatcgtcaatgccaagatcatcgcactcgacgacgccgtacagggatatgaaagcttc
gaccagggtgccgcaaccaagttcgtgctcgatccgcatggcgatctgctgaagtcggcc
tga

DBGET integrated database retrieval system