KEGG   Agrobacterium sp. H13-3: AGROH133_06445Help
Entry
AGROH133_06445    CDS       T01432                                 

Gene name
tpiA
Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGROH133_06445 (tpiA)
   01230 Biosynthesis of amino acids
    AGROH133_06445 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_06445 (tpiA)
   00051 Fructose and mannose metabolism
    AGROH133_06445 (tpiA)
   00562 Inositol phosphate metabolism
    AGROH133_06445 (tpiA)
Enzymes [BR:agr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AGROH133_06445 (tpiA)
Exosome [BR:agr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AGROH133_06445 (tpiA)
  Exosomal proteins of bladder cancer cells
   AGROH133_06445 (tpiA)
  Exosomal proteins of melanoma cells
   AGROH133_06445 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1569886..1570656)
Genome map
AA seq 256 aa AA seqDB search
MTPNVRPLVAGNWKMNGTRSSLDQIKAMAEGVKGALSEKVDALICPPSTLLYVATALCDD
SPLMIGGQDCHQNVSGAHTGDISAEMIADCFGTHVIVGHSERRTDHAETDHLVRAKAVAA
HQADLIAIVCIGETADERKAGQTLDILKRQLAGSLPDEATAENTVIAYEPVWAIGTGLTP
TTQDVREAHAFMRDELVKRFGDEGKTMRILYGGSVKPANALELMGVENVDGALIGGASLK
ASDFLSIYAAYEQLTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaatgttcgaccgcttgtagccggaaactggaagatgaacggcacccgttcg
tcgctcgatcagatcaaggccatggctgagggcgtcaagggcgcgctttcggaaaaggtg
gatgcgctgatctgcccgccatcgacgcttctttatgtggcaaccgcgctctgcgacgac
agcccgctgatgattggcggacaggattgccaccagaatgtttccggcgcgcatacgggt
gacatttccgccgagatgattgccgattgcttcggcacccatgtcatcgtcggccactcc
gagcgtcgcaccgaccatgccgagacggatcatctggtccgtgccaaggccgttgccgcc
caccaggccgatcttattgcgatcgtctgcattggcgagacggcggatgagcgcaaggcg
ggccagacgctcgatatcctcaagcgccagctcgccggatcgcttccggacgaggcaacc
gccgaaaacaccgtcatcgcttatgagccggtctgggcgatcggcacgggtctgacgccg
accacgcaggatgtacgcgaggcccatgccttcatgcgcgacgagctggtcaagcgcttt
ggtgatgaaggcaagaccatgcggattctttacggcggctcggtgaagcctgccaatgcg
ctggaactgatgggtgtcgagaatgtcgacggcgcactgattggcggcgcgagcttgaaa
gcctccgacttcctttccatctatgcggcatacgagcaactgacggcttga

DBGET integrated database retrieval system