KEGG   Agrobacterium sp. H13-3: AGROH133_06575Help
Entry
AGROH133_06575    CDS       T01432                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
agr  Agrobacterium sp. H13-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638057..1639127
Genome map
AA seq 356 aa AA seqDB search
MNTASTPKSTGPDIAGQIAYAMRSMGVSPIPRNYSLFYEAYIGSNPALTRDLAALGNRVT
QEDLDELSTRYGEGNPIASIDDAHEKLRRELEALLGTLRREQSSIENYNRILGETRQRID
DKTVSSTNILKNAVSLLAEATGSKIIDGEKAFNDVNRHAEEMQQVRLELDEYKRIANTDS
LTRLSNRRAFDDRLASVYNSSIGLQYTTLILLDIDHFKRINDTFGHPVGDKILATVASVI
RANVRKDGFVARSGGEEFAIILDGNTPEEVMVICERIRLSLESTPFRNSRSGADYGTVTI
SIGFASASQANNPGELYGHADMALYHAKETGRNRSVIYEDGMQKNYIGKNWLIYRT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggcatccacgcccaaatccacggggcccgacatcgccgggcagattgcctat
gccatgcggagcatgggtgtgtcgccgatcccgcgcaactatagccttttttacgaagcc
tatattggttcgaacccggcgctgacgagggatctggcggcactgggaaaccgggtgacg
caggaggatctggacgaactgtccacgcggtacggggaaggcaatcccatcgcctcgatc
gacgacgcgcacgagaagctgcggcgtgaactggaggcgcttctcggaacgctgaggcgc
gaacagtcctccatcgagaactacaacagaattctcggcgaaacccgccagcgcattgac
gacaagaccgtatcgagcaccaatatcctgaaaaatgcggtctcgctgctggccgaggcc
accggctcgaaaatcatcgatggcgaaaaggcgttcaacgacgtcaaccgccatgccgag
gaaatgcaacaggtgcgtctggagctggatgaatacaagcgcatcgccaataccgattcg
ctgacgcgcctttccaaccgtcgcgctttcgatgacaggctggcctccgtctacaacagc
tccatcggcctgcaatatacgacgctcatcctgctcgacatcgaccatttcaagcggatc
aacgatacgttcggccacccggtcggcgacaagatactggccaccgtcgcctccgtcatc
cgcgccaatgtccgcaaggacggcttcgtcgccagaagcggcggcgaggaattcgccatc
attcttgatggcaacacgccggaagaagtcatggtgatctgtgagcgcatccgcctgtcg
ctggaaagcacgccgttccgcaattcacgatcgggcgccgactacggtacggtgacgatc
tcgatcggcttcgcctccgcctcgcaggcaaacaatccgggcgaactttacggacatgcc
gatatggcactttaccacgccaaggaaaccggcaggaaccgttccgtcatttacgaggac
ggcatgcagaagaactatatcggcaagaactggctgatttatcggacgtga

DBGET integrated database retrieval system