KEGG   Agrobacterium sp. H13-3: AGROH133_06575Help
Entry
AGROH133_06575    CDS       T01432                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
agr  Agrobacterium sp. H13-3
Brite
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AGROH133_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
circular:1638057..1639127
Genome map
AA seq 356 aa AA seqDB search
MNTASTPKSTGPDIAGQIAYAMRSMGVSPIPRNYSLFYEAYIGSNPALTRDLAALGNRVT
QEDLDELSTRYGEGNPIASIDDAHEKLRRELEALLGTLRREQSSIENYNRILGETRQRID
DKTVSSTNILKNAVSLLAEATGSKIIDGEKAFNDVNRHAEEMQQVRLELDEYKRIANTDS
LTRLSNRRAFDDRLASVYNSSIGLQYTTLILLDIDHFKRINDTFGHPVGDKILATVASVI
RANVRKDGFVARSGGEEFAIILDGNTPEEVMVICERIRLSLESTPFRNSRSGADYGTVTI
SIGFASASQANNPGELYGHADMALYHAKETGRNRSVIYEDGMQKNYIGKNWLIYRT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggcatccacgcccaaatccacggggcccgacatcgccgggcagattgcctat
gccatgcggagcatgggtgtgtcgccgatcccgcgcaactatagccttttttacgaagcc
tatattggttcgaacccggcgctgacgagggatctggcggcactgggaaaccgggtgacg
caggaggatctggacgaactgtccacgcggtacggggaaggcaatcccatcgcctcgatc
gacgacgcgcacgagaagctgcggcgtgaactggaggcgcttctcggaacgctgaggcgc
gaacagtcctccatcgagaactacaacagaattctcggcgaaacccgccagcgcattgac
gacaagaccgtatcgagcaccaatatcctgaaaaatgcggtctcgctgctggccgaggcc
accggctcgaaaatcatcgatggcgaaaaggcgttcaacgacgtcaaccgccatgccgag
gaaatgcaacaggtgcgtctggagctggatgaatacaagcgcatcgccaataccgattcg
ctgacgcgcctttccaaccgtcgcgctttcgatgacaggctggcctccgtctacaacagc
tccatcggcctgcaatatacgacgctcatcctgctcgacatcgaccatttcaagcggatc
aacgatacgttcggccacccggtcggcgacaagatactggccaccgtcgcctccgtcatc
cgcgccaatgtccgcaaggacggcttcgtcgccagaagcggcggcgaggaattcgccatc
attcttgatggcaacacgccggaagaagtcatggtgatctgtgagcgcatccgcctgtcg
ctggaaagcacgccgttccgcaattcacgatcgggcgccgactacggtacggtgacgatc
tcgatcggcttcgcctccgcctcgcaggcaaacaatccgggcgaactttacggacatgcc
gatatggcactttaccacgccaaggaaaccggcaggaaccgttccgtcatttacgaggac
ggcatgcagaagaactatatcggcaagaactggctgatttatcggacgtga

DBGET integrated database retrieval system