KEGG   Agrobacterium sp. H13-3: AGROH133_06619Help
Entry
AGROH133_06619    CDS       T01432                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartyl protein carboxyl methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
agr  Agrobacterium sp. H13-3
Brite
Enzymes [BR:agr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AGROH133_06619 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_11 Methyltransf_25 Methyltransf_31 CMAS GCD14 Methyltransf_23 MTS Methyltransf_4 Methyltr_RsmB-F DREV tRNA_U5-meth_tr PrmA
Motif
Other DBs
NCBI-ProteinID: ADY64630
UniProt: F0L5R8
Position
circular:complement(1649030..1649683)
Genome map
AA seq 217 aa AA seqDB search
MKSAMVEKEGFAALVLRLRGEGISDLDLLTAVEQTPRSRFVPPQFAADAYSSRTIPIDCG
AFMEGADMAVKILARLQLKPGQRVLEIGTGSGFMTAIIARRVERVFSLERYKTLVQQAQN
CLDDLSIRNVVIRQADGSNGLVGEGTFDRIVATAAFTTMPRFFAEQIVSGGMMIAPIILE
DGRCVMTRFSKTGSRFEKEELFETPYLPLGSHIARHL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatccgcaatggttgaaaaggaaggttttgccgctctcgttctccgcttgcggggc
gaggggatttccgacctcgaccttttgacggcggtcgaacagacgccgcgctccagattc
gtgccgccgcaattcgccgctgatgcctattccagccgcacaatcccgatcgactgcggc
gccttcatggaaggcgctgacatggcggtgaaaatcctggcccgcctgcaattgaagccg
ggccagcgcgtgctggaaatcggtaccggcagcggtttcatgacggcgatcatcgcgcgc
cgggtggagcgggtcttttcgctggagcgctacaagacgctggtgcagcaggcgcagaac
tgtctggacgatctttccatccgcaatgtcgtcatccgccaggcggatggcagcaacggt
ctggtcggcgagggcaccttcgaccgaatcgtcgccaccgccgcctttaccaccatgccc
cgctttttcgccgagcagatcgtctccggcggcatgatgatcgcgccgatcattctggaa
gacgggcgctgcgtgatgacgcgcttctccaagaccggcagccgcttcgagaaggaagag
ctgttcgagacgccctatctgccgcttggcagccatattgcccggcatttgtga

DBGET integrated database retrieval system