KEGG   Agrobacterium sp. H13-3: AGROH133_06621Help
Entry
AGROH133_06621    CDS       T01432                                 

Gene name
serS
Definition
(GenBank) Seryl-tRNA synthetase
  KO
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:agr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    AGROH133_06621 (serS)
Enzymes [BR:agr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     AGROH133_06621 (serS)
Amino acid related enzymes [BR:agr01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   AGROH133_06621 (serS)
Transfer RNA biogenesis [BR:agr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AGROH133_06621 (serS)
 Prokaryotic Type
    AGROH133_06621 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
circular:complement(1650663..1651946)
Genome map
AA seq 427 aa AA seqDB search
MHDIKWIRENPEAFDAALARRGAEPAASSLIALDEKRRSVIQSLQDMQSRRNAASKDIGA
AMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVTAELNDALSRLPNIPFDDVPDGKDEH
DNVVTRVVGQKPGWNHEAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQ
FMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFSEDLFKTTDGRWLIPTAEVTLTNLV
SGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE
RMTACAEEVLKRLGLHFRTMTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQ
ARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPNVLLPYMGGL
KRIEKAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacattaaatggatacgcgaaaaccccgaagcctttgatgcagcacttgcacgg
cgcggcgcagagcctgccgcaagcagcctgatcgctctcgacgaaaagcgccggtccgtc
atccagtccctgcaggacatgcagtcgcgtcgcaatgccgcttccaaggacatcggcgcc
gccatggcgcagaagaacatggagctggcggaaaagctgaaagcggaagtcgccgacatc
aaggaaaacatgccgcgcgccgaggaggaggaccgccaggtcaccgccgagcttaacgac
gccctgtcgcgcctgcccaatatacctttcgacgatgttcctgacggtaaggacgaacac
gacaatgtggtgacccgcgtggtcggccagaagccaggctggaaccatgaagcaaaggag
cacttcgagattggcgaagcgctcggctacatggatttcgagcgggctgccaagctttcc
ggctcgcgcttcaccgtgctgaccagccagctggcgcgtctggaacgagcgctcggccag
ttcatgatcgacctgcacacctcggaacatggctacacggaagtgtcttcgccgctgatg
gtgcgcgatgaggcgatgttcggcaccggccaattgccgaagttttccgaggatctgttc
aagactaccgatggccgctggttgatcccgacggcggaagtgactctgaccaaccttgtc
tccggcgaaattctcgagcaggaaaagctgccgctgcgctttacggcacttacgccgtcc
ttccgttcggaagcgggctctgctggccgcgacacacgcggcatgctgcgccagcaccag
ttctggaaatgcgaactcgtctccatcaccgacgcggaaagtgctgttgccgagcatgag
cgcatgacggcctgcgccgaagaagtgctgaagcgtcttggcctgcatttccgcaccatg
acgctgtgcaccggcgatatgggtttcagcgcgcgcaagacctacgatctggaagtgtgg
ttgcccggccagaacacctaccgcgaaatttcgtcctgctccgtctgcggcgatttccag
gcgcggcgcatgaatgcgcgttatcgcggcaaggacgacaaggcgacgaagttcgtgcac
acgctgaacggctccggcaccgccgtcggccgctgcctcatcgcggttctcgaaaattac
ctgaacgacgacggttccgtcacaattccaaacgtgctgctgccctatatgggcggtctg
aagcggattgagaaagcggcctga

DBGET integrated database retrieval system