KEGG   Agrobacterium sp. H13-3: AGROH133_06710Help
Entry
AGROH133_06710    CDS       T01432                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AGROH133_06710 (folE)
Enzymes [BR:agr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AGROH133_06710 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697648..1698274
Genome map
AA seq 208 aa AA seqDB search
MDAIVKNFPGAGAKPDVAEARPSQTEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRE
LFAGYELNVQDVLGTTFEEVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVL
GLSKIARVVEIFGRRLQTQENMTAQIARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQGS
TTLTTSFTGTFKNDPAEQVRFMTMVRNR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatcgtgaagaatttccccggcgctggcgcaaaacccgatgtggcagaggct
cgcccaagccagacggaagcggaagaagcagtgcgcgttcttctgcgctgggcaggagaa
aatcccgcccgcgaaggacttctggacacgccgaagcgcgttgccaaggcctatcgcgaa
ctcttcgccggttacgagctgaacgtccaggacgttctcggcacgaccttcgaggaagtt
ggcggttatgacgatgtggtgctggtgcgcgacatccccttcttctcccattgcgaacac
cacatggttccgatcgtcggcaaggcgcatgtcgcctatcttccggccgggcgcgtgctc
ggcctgtcgaagatcgcccgcgtcgtcgaaatctttggccgccgcctgcagacgcaggaa
aacatgaccgcgcagatcgcaagatccatcgaggaaactctgaagccgcgcggcgtggcc
gtcatgatcgacgccgaacatatgtgcatgtccatgcgcggcgtaaacaagcaggggtcc
acgaccctcaccaccagcttcaccggcaccttcaagaacgacccggcggagcaggtgcgc
ttcatgaccatggtgcggaaccgctaa

DBGET integrated database retrieval system