KEGG   Agrobacterium sp. H13-3: AGROH133_06973Help
Entry
AGROH133_06973    CDS       T01432                                 

Gene name
glsA
Definition
glutaminase A (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:agr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:agr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:agr00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1816904..1817833)
Genome map
AA seq 309 aa AA seqDB search
MQDIQAIVDSIYDSMVPRLGEGKVADYIPELAKVDPNQFGIAITTVDGTTYTAGNALTPF
SIQSISKVFMLTLALGKAGETVWNRVGREPSGSSFNSIVQLEHEHGIPRNPFVNAGAIVV
TDIVLSGHQPREAIGELLRFVRYLADDDTISIDDTVAKSEQATGFRNFALANFMRSFGNL
HHPVEYTLGVYFHQCALSMTCAQLSRAGLFLANRGRNPLSGHTVVSDRRARRINALMLTC
GHYDGSGDFAYHVGLPGKSGVGGGIMAVAPGKASIAVWSPGLNKVGNSALGSHALEMLAT
KTGWSVFGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacattcaggcgatcgtcgattccatttacgacagcatggtgccgcgcctgggc
gagggcaaggttgcggattacattccggaactcgccaaggtcgatccgaaccagttcggt
atcgccatcaccactgtcgacggaaccacctatacggctggcaatgcgctcacgccgttt
tcgatccagagcatctccaaggtcttcatgctgacgctggcgctcggcaaagcgggcgag
acggtgtggaaccgggtggggcgtgagccgtcggggtcgtccttcaactccatcgtccag
ctggagcatgagcacggcattccgcgcaatcccttcgtcaatgccggtgccatcgtggtg
acggatatcgttctttccggccaccagccgcgcgaggcgattggcgagcttctgcgtttc
gtccgttatctcgctgacgatgacacgatcagcattgatgacaccgtggcgaaatccgag
caggcgacgggtttccgcaatttcgcgcttgccaatttcatgcggtccttcggcaatctg
catcaccccgttgaatatacgctgggcgtctattttcatcagtgcgcgctgtccatgacc
tgcgcgcagctttcacgggccggtcttttccttgccaatcgcggccgaaatccgctgagt
ggtcatactgttgtgtcagaccgacgcgcgcggcgcatcaatgcgctgatgctgacctgc
ggccattatgacggttcgggcgatttcgcctatcatgtcggcctgccgggcaagagcggc
gtgggcggcggcatcatggcagtcgcgccgggcaaggcgtcgattgcggtctggtcgccg
ggtctgaacaaggtcggcaattcggcgcttgggtcgcatgcgctggaaatgctggcgacg
aaaaccggctggtcggtattcggggcttga

DBGET integrated database retrieval system