KEGG   Agrobacterium sp. H13-3: AGROH133_07309Help
Entry
AGROH133_07309    CDS       T01432                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
agr  Agrobacterium sp. H13-3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:agr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:agr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1961195..1961410)
Genome map
AA seq 71 aa AA seqDB search
MAGGGEIYRQAMPFADQLSVTHVAVKLDGDTFFPEIDPAVFEKIEENAVPAGEKDNYPVL
FTTYLRRAASK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtggccggtggcggggaaatctaccgtcaggccatgccgtttgccgatcaactttccgtc
acccatgtggccgtaaagcttgatggcgacactttttttccggaaatcgatcccgccgtg
tttgaaaaaatcgaggaaaatgccgttcccgccggggaaaaggacaattatccggttctg
ttcaccacttatttgcgcagagccgcgtcaaagtga

DBGET integrated database retrieval system