KEGG   Agrobacterium sp. H13-3: AGROH133_07358Help
Entry
AGROH133_07358    CDS       T01432                                 

Gene name
pncA
Definition
(GenBank) pyrazinamidase / nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00760  Nicotinate and nicotinamide metabolism
agr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AGROH133_07358 (pncA)
Enzymes [BR:agr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AGROH133_07358 (pncA)
    3.5.1.-  
     AGROH133_07358 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADY64979
UniProt: F0L7W0
Position
circular:1985196..1985822
Genome map
AA seq 208 aa AA seqDB search
MKALLLIDIQNGFCPGGNLAVADGDRIVPVANALIDNGGYDLIVASQDWHPENHGSFASQ
HVGKKPFDMGELSGKPQMMWPDHCVQGTPDAEFHPDLKTEAFDYIQQKGENPAVDSYSAF
RDNDQGATTGLADYLTRQGVTQLDICGLATDYCVSFSVLDALDMLPGVKVRFIEDASRGI
DPQGIQASIAAMREKGATILKSRDILRD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgctgctcatcgatatccagaacggcttttgtccgggcggtaatctggct
gtcgccgatggcgaccggatcgtgcccgtcgccaatgccctgatcgacaatggcggttac
gatctgatcgtcgcctcgcaggattggcacccggaaaatcacggtagctttgcctcgcag
catgtcggcaagaagccgttcgatatgggtgaactctccggcaaaccgcagatgatgtgg
cccgaccattgcgtgcagggcacgccggatgcggaattccatcccgacctcaagacggag
gctttcgactatatccagcagaaaggcgaaaatcccgccgtcgacagctattccgccttt
cgcgacaatgatcagggggcaacgacaggtcttgccgattatctgacacgccaaggcgta
acccagctcgacatatgcgggctcgccaccgattattgcgtcagtttctcggtgctcgat
gccctcgacatgctgcctggcgtcaaggttcgtttcatcgaggatgccagccgcggcatc
gatccccaaggtatacaggcgtcgattgcggccatgcgggaaaaaggcgccaccatcctc
aaaagccgcgacattttgcgcgactga

DBGET integrated database retrieval system