KEGG   Agrobacterium sp. H13-3: AGROH133_07980Help
Entry
AGROH133_07980    CDS       T01432                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AGROH133_07980 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AGROH133_07980 (bdhA)
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AGROH133_07980 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230930..2231418
Genome map
AA seq 162 aa AA seqDB search
MHRTVIVTGSTSGIGLGIAQRFAREGANIVLNGFGDEDEIEKLRLLLEAESGGRVLYHPA
DMTKPDEIADLINSAHEKLGSVDVLVNNAGIQHIAPIEEFPTEKWDWIIAINLTSSFHTM
RVAIPLMKKAGKGRIINIASAHGLVASPFKSAYVAASTASWA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggacagttatcgtgacaggctccacaagtggcatcggccttggcatcgcacag
agatttgcgagggagggcgcgaatatcgtgctgaatggcttcggcgacgaagacgaaatt
gaaaaactccgcctcttgctggaagccgaaagtggcgggcgtgtgctctaccacccggca
gatatgacgaaaccggacgagattgccgatctcatcaattccgcgcatgaaaagcttggt
tcggtcgatgtgctcgtcaacaatgccggcattcagcacatcgctccgatcgaggagttt
ccgacggaaaagtgggactggatcatcgccatcaatctgaccagttccttccatacaatg
cgcgttgcgataccgctgatgaagaaggccggcaaaggccgtatcatcaacattgcctct
gcccacggtctcgtcgcctcgccgttcaaatcggcctatgtggcagccagcacggcatca
tgggcctga

DBGET integrated database retrieval system