KEGG   Agrobacterium sp. H13-3: AGROH133_08127Help
Entry
AGROH133_08127    CDS       T01432                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
agr  Agrobacterium sp. H13-3
Brite
Enzymes [BR:agr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AGROH133_08127 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2288030..2289100)
Genome map
AA seq 356 aa AA seqDB search
MRIGRRNFLGGAVSAGLLHAMAGQGVAATRKTSTKIAPYGAAIYLPDLTADSRIGEAVVK
YCSRITPVTEMKWEVMRPSAEVFDFAAADALANFARQNKLTMHGHPLIWYASNAPWLASI
GSGAKVEKLMETHIVKVMERYKDVIHSWDVVNEPIPDVPGNVRSRRDAWYYGAGPDAIKK
AFDIAHSVDPKAQLVLNEYDVEFAVEKSLAKRAAFRNLILELLEKGAPINAIGLQGHLRG
GWPIAKDELAAFTKEMRSYGLAVLVTELDAMDQTLPAPEAERDMLINGQVRDFLEAACEG
GPLSSITTWGISDQYTWIRWAYPRRDGTANRPLPLDWSFNEKPMMAVINEFRNRGA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgggcggcggaattttctgggtggtgctgtaagcgcgggcctgttgcatgcc
atggcagggcagggcgttgccgcgaccaggaaaacgtcgacaaagattgccccttacggt
gcggccatctatctgccggaccttaccgccgatagccgcatcggcgaagcggtggtcaaa
tattgctcgcgcatcaccccagtcacagagatgaaatgggaggtcatgcggccttcggca
gaggtgttcgattttgccgctgccgatgcgcttgcgaacttcgcgcgccagaacaaactc
accatgcatggtcatccgcttatctggtacgcttccaacgcgccctggcttgccagcatc
ggcagcggcgccaaggtcgagaagttgatggaaacccacatcgtcaaggtgatggaacgg
tacaaggacgtgatacacagctgggatgtggtcaatgaacctatccccgacgtgcccggc
aatgtgcgctcgcgccgcgacgcctggtattatggcgcaggcccggacgccatcaaaaag
gcctttgacatcgcccattccgtcgatccgaaggcccagcttgtcctcaacgaatatgat
gtggaatttgcggtcgagaaatcgctggccaagcgcgcggccttccgcaatctcattctc
gagttgctagagaaaggcgctccgatcaacgctatcggcctgcaggggcatctgcgcggt
ggctggcccattgcgaaagacgagcttgcagcctttaccaaggaaatgcgcagttatggt
cttgccgttctggtgacggaactggacgcgatggaccagacgcttcccgccccggaagcc
gagcgcgacatgctgataaacggtcaggtccgcgattttctcgaagcggcgtgcgaaggc
ggcccgctttcctccatcaccacatggggcatttcagaccaatatacctggatccgctgg
gcctatccccgccgggatggcaccgcgaaccggccgctgccgctcgactggagcttcaac
gaaaaacccatgatggccgtcatcaatgaattccggaaccgtggtgcgtaa

DBGET integrated database retrieval system