KEGG   Agrobacterium sp. H13-3: AGROH133_08288Help
Entry
AGROH133_08288    CDS       T01432                                 

Gene name
pssB
Definition
exopolysaccharide production protein PssB
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AGROH133_08288 (pssB)
Enzymes [BR:agr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AGROH133_08288 (pssB)
Transfer RNA biogenesis [BR:agr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AGROH133_08288 (pssB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342786..2343580
Genome map
AA seq 264 aa AA seqDB search
MIDILTKAALDAGQAIMAVHRAGPHVSYKDDCSPVTEADQRAEVIILQALAAHFPQIPVI
AEEAVSNGILPETGTEFFLVDPLDGTKEFISGKDDFTVNIALIRNGVPVAGVVYAPCRGQ
AWTGKDNSAEKLAISGEGAILARHPIRARQRGASPVALISRSHCTAKTEAFVAEHGLKDC
ISVGSSLKFCMLAEGAADIYPRFSRTMMWDTAAGDAVLRAAGGRTLDCEGRLLAYEVRGD
GEDALANPDFIAEGAMAATVEIAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatattgacgaaagcggcgctggacgccgggcaggcaatcatggcggtccat
cgcgccgggccacacgtatcgtacaaggacgattgctcgcccgtgaccgaggcagaccag
cgggcggaggtgatcattctgcaggcactggctgcgcattttccccaaatcccggtcatt
gccgaagaagcggtctcgaacggcattctgccggagacaggcacggaattttttctggtc
gatccgctggatgggaccaaggaattcatttccggcaaggatgattttaccgtcaatatc
gccctgatcagaaacggcgtgccggttgcgggcgtggtttacgccccctgccgcggccag
gcctggaccggcaaggacaacagcgccgaaaagctcgcaatatcaggcgaaggagcgatc
ctcgcgcgccaccccatccgggcacgccagcgcggcgcctcccccgtggcgctgatcagc
cgctcgcactgtaccgcgaaaacggaagccttcgtggccgaacacggcctgaaagactgc
atttccgttggttcctcactgaaattctgcatgctggcggaaggtgctgccgatatctat
ccccgcttcagccgcaccatgatgtgggatacggcggcaggcgacgccgtactgcgcgcc
gccggtggcagaacgctggattgcgagggccggctgcttgcctatgaggtgagaggcgat
ggtgaagatgcactcgccaacccggatttcattgccgagggcgcaatggcagcgacggtg
gaaattgcgcgatag

DBGET integrated database retrieval system