KEGG   Agrobacterium sp. H13-3: AGROH133_08765Help
Entry
AGROH133_08765    CDS       T01432                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AGROH133_08765
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AGROH133_08765
Enzymes [BR:agr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AGROH133_08765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2554198..2556117)
Genome map
AA seq 639 aa AA seqDB search
MALAQFRLENSWHPLEDSASGGFTFTLFNLSSEAVKDFRIVYTSLTRTIDKPVCGNAVYL
RRNANFHEFAPPTGFVLEAGKSWRFTVDGLLRPARHRTDGAKSAYISLADGTHRAVDVAD
LMLDGRHSEPAPALLPEGKLDLPFAIQPWPAEIDAAPGEDFPVALFPTEEAGKEEVLAVE
TVSSLFRRLFAVGHVPFSLAPVHEGKPLRFKQHSGLEAEGYRLSFSDDAVVVEYSAAAGL
QYGLTVLAQLLHGARTDTKFRFPVSGTIADAPRYSWRGCHLDVSRQFYPTGDVVRLIDIL
AWLRMNRFHWHLTDDEAWRLEIKAYPLLTTVGATRGPDAPLLPQLGNGAEPVSGYYSQDD
VRMVVAHAAALNIEIVPEVDIPGHSTAALVAYPELTDGQEAPDSYRSVQGYPNNALNPAI
EPTYEFLGKIFDEMVELFPSRLIHIGGDEVADGSWLASPLAKSLMEKEGLDGTFGIQSYF
MKRIQGMLHERGRQLAGWDEVSHGGGVDPSGTLLMAWQKPEVGLELAKQGYDVVMTPGQA
YYLDMVQDEAWQEPGASWAGTVPPSHTYAYEAVGEFPEELKERMKGVQACIWSEHFLNRA
YFNHLVFPRLPAIAEAAWTPKAQKDWLRFSAIVRLSPVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcacaatttcgtctcgaaaactcatggcatccgctcgaagattctgcatcg
ggtggcttcaccttcaccctgttcaatctttccagcgaggcggtgaaggatttccggatc
gtctatacgtcgctgacgcggaccatcgacaagcccgtttgcggcaacgccgtctatctg
cgccgcaatgccaatttccatgaatttgcgccgccaacgggtttcgtgctcgaagccggg
aaatcgtggcgttttaccgttgacggcctgctcaggcctgcccgccatcgcacagacggt
gcgaaatccgcctatatcagccttgccgacggcacacatcgcgcggttgatgtcgctgac
ctgatgcttgacgggcgccatagcgagccggcgccagccctgcttcccgaaggaaagctc
gatctgcccttcgccatccagccttggcctgcggaaatcgatgccgcgccgggcgaagac
tttcccgtcgcactcttcccgacggaagaggcaggcaaggaagaagtgcttgcggtggaa
actgtttcgtcgctgttccgcaggctttttgccgttggtcacgtgcctttcagcctcgcg
cctgttcatgagggcaaaccgcttcgtttcaagcaacatagcggtctggaagcggaaggt
tatcgcctgtctttctctgatgacgccgtcgtcgtggaatattcggccgctgcaggtctg
caatacggcctgaccgtgcttgcgcaattgctgcacggcgcgcgcaccgataccaaattc
cgtttcccggtttccggcaccatcgccgatgcgccgcgttacagctggcgcggttgccat
ctggatgtctcgcgacaattctatccgaccggtgatgtcgtgcggctgatcgacattctt
gcatggctgcgcatgaaccggttccattggcacctgacggatgacgaggcctggcgtctc
gaaatcaaggcctacccgctgctgacgacagtcggcgcgacgcgcggcccggatgcgccg
cttctgccgcagctcggcaatggggctgagccggtttccggttattactcgcaggatgat
gttcgcatggtcgtcgcgcatgcggcggcactgaacatcgaaatcgtgccggaggtcgat
attcccggccacagcacggcagctctcgttgcctatccggagctgacggatgggcaggaa
gcgccggacagctatcgctccgtacagggctatcccaacaatgcgctcaatcccgccatc
gagccgacctatgaattccttggcaagatattcgacgagatggtggagcttttcccctcg
cggctgatccatatcggcggcgacgaggtagcagatggctcctggcttgcctcgccgctt
gccaagtcgttgatggaaaaggaaggcctcgacggcacctttggtatccagtcctatttc
atgaaacgtattcaggggatgctgcatgagcgcggccgccagcttgccggctgggacgaa
gtttcgcacggcggcggcgtcgatccctcgggaacattgctgatggcctggcagaagccg
gaagttggcctggagcttgcaaagcagggctacgacgtcgtgatgacgccgggacaggcc
tattatctcgacatggtgcaggatgaagcctggcaggagccgggcgcaagctgggccggc
accgttccgccgtcgcacacatatgcttacgaggcagtcggtgagtttcccgaggaattg
aaggagcgaatgaaaggcgttcaggcctgcatctggtccgagcatttcctcaatcgcgcc
tatttcaaccatctggttttcccgaggctgcccgccattgccgaagcggcgtggacgccg
aaagcgcagaaggactggctgcgtttctccgccatcgtccgcttgagcccggtctattga

DBGET integrated database retrieval system