KEGG   Agrobacterium sp. H13-3: AGROH133_08806Help
Entry
AGROH133_08806    CDS       T01432                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00900  Terpenoid backbone biosynthesis
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AGROH133_08806 (dxr)
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AGROH133_08806 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADY65526
UniProt: F0L3D1
Position
circular:2570658..2571986
Genome map
AA seq 442 aa AA seqDB search
MALPSAKTIARLCPCYDRFSRVEASACRQKLCIGFGQPETTDGRKMTDTSEMPRRLTILG
STGSIGTNTLDVVRQLGGRRQFEVLALTGAGNIDLLAQQAREFGAQLAVTAEDGKYEALK
AALAGTGIEVAAGKSGLEEAASMEAGWVMAAIAGTPGLAPTLTAARRGADIALANKECLV
SAGDVFLRTVKQGGGRLIPVDSEHSAIFQCLTGDHKQAVERIVLTASGGPFRTWSREQMA
NVTADIARAHPNWSMGLKVSIGSASMFNKGLEMIEAKYLFDLRPEQVEVIVHPQSIIHSM
VGYTDGSYIAQLGSPDMRTAISYALTYPERGNLNVERLDFAKLARLDFEAPDEARFPALR
LARTALERGGLQGAALNAAEETAFHAFVKGGIGFLDMAEIVETVMDRMHDGRSANSIEDV
FSADGEARNHARELIASKEKAA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctttgccatccgcaaaaacaatagcccggctgtgtccttgttatgaccggttttca
cgagtagaggctagtgcatgtcgccagaaactatgcatcggtttcgggcaaccggaaacg
accgacggacggaagatgacagataccagtgaaatgccacgcaggctgacgatattgggt
tcgacgggttcgatcggtacgaacacactggatgtcgtccgtcagctgggtggtcgcaga
caattcgaggttttggcgctcaccggcgccggaaacatcgatcttctggcgcaacaggcg
cgtgaattcggcgcgcagcttgcggtaaccgccgaggatggcaaatacgaagcgctgaaa
gcggcccttgctggcaccggcattgaagttgcggcgggcaaatccggcctcgaagaagcg
gcctctatggaggccggctgggtaatggcagcgattgccggaacacctggtcttgccccg
acattgacagccgcacggcgcggcgcagacatagcgcttgccaacaaggaatgcctcgtt
tcagcaggcgacgttttcctgcgcacggtcaaacagggcggcggcaggttgatcccggtc
gatagcgaacatagcgcgatattccagtgcctgacgggcgatcacaaacaggccgtggag
cgcatcgtactcaccgcatccggcggaccctttcgcacctggtcgcgtgagcagatggcc
aatgtcacggcagatatcgcccgtgcccatcccaactggtctatggggttgaaggtatcg
atcggcagcgcctcgatgttcaataaggggctggaaatgatcgaggcgaaatatctcttc
gatctcaggcccgagcaggtggaggtgatcgttcatccgcagtcgatcatacattcgatg
gtgggttatactgatggctcctacatcgcccagctcggctcgcccgatatgcgcaccgcc
atctcctatgccctcacctaccctgagcgcggcaatctcaatgtcgagcgcctggatttc
gccaagctggcgcggctcgatttcgaagcgcctgatgaggccaggtttccggcgctccga
ctggcgcgcacggcgctggagcgcggaggcttgcagggcgcggccctaaatgccgccgaa
gaaaccgcctttcacgccttcgtcaaaggcggcatcgggtttctcgatatggccgaaatc
gtcgaaacggtcatggaccgcatgcatgacggccgatcagccaacagcatcgaagacgta
ttttcggcggacggggaagcccgtaatcacgcgcgggaactgatcgccagcaaagaaaag
gccgcgtaa

DBGET integrated database retrieval system