KEGG   Agrobacterium sp. H13-3: AGROH133_08860Help
Entry
AGROH133_08860    CDS       T01432                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
agr  Agrobacterium sp. H13-3
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGROH133_08860 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGROH133_08860 (sdhD)
   00650 Butanoate metabolism
    AGROH133_08860 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AGROH133_08860 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2610674..2611054)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLLIFFVVFLIKYAGAPYPEVAAALS
NPLVAVIMGLVLVSGLIHMKLGMQVIIEDYVHGEVSKLVLLMLNTFFAVLIGGLCIFAIL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtacacctctcggaaaggttcgtggcctcggctccgccaaggaaggcaca
gaccatttctggcgccagcgccttacggccgtcgccaacgtgccgttgctgatcttcttc
gtggtctttctcatcaaatatgccggcgctccctatccggaagttgcggcggcgctttcc
aaccctctcgttgcggtcatcatgggtctggtgctggtttccggcctcattcacatgaag
ctcggcatgcaggtcatcatcgaagactacgttcacggcgaggtttcgaagctcgttctt
ctgatgctcaatacgtttttcgcggttctcattggcggtctttgcatcttcgccattctg
aaaatcgcattcgcaggataa

DBGET integrated database retrieval system