KEGG   Agrobacterium sp. H13-3: AGROH133_08948Help
Entry
AGROH133_08948    CDS       T01432                                 

Gene name
tesA
Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AGROH133_08948 (tesA)
Enzymes [BR:agr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AGROH133_08948 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AGROH133_08948 (tesA)
Lipid biosynthesis proteins [BR:agr01004]
 Fatty acid synthase
  Component type
   AGROH133_08948 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641924..2642574)
Genome map
AA seq 216 aa AA seqDB search
MRFKAALFHFIVIFAAAFSASAAVAQERTLQLVGLGDSLMAGYQLPPTDGYTAQLEAALK
AKGINVTVTNAGVSGDTSSGGLARAEWSVPDGTDGVILELGANDALRGIAPEQTEKNLDA
IISSFQKRNIAVLLVGIMAPPNMGDDYAKRFNPIYPKLAEKYNLPLYPFFLDGVVTDDKL
KLEDKMHPNTQGVAMMVEKSLPAVESFIKTIGAQKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaagctgccctgtttcacttcatcgtcattttcgccgccgccttttccgcc
tcggcggccgtggcgcaggagcggacattgcaattggttggcctgggcgacagtctcatg
gcgggttaccagttaccccccaccgatggctatacggcacagcttgaagctgcattaaag
gccaagggcatcaatgttaccgtcaccaatgccggtgtgtccggcgatacgtcctcaggc
ggtctggctcgggcggagtggtcggttcccgatggcacggacggggtcattctggaactc
ggcgccaatgatgcgttgcgcggtattgcgccggaacagacggaaaagaacctcgacgcc
atcatttccagctttcagaaacgcaacatagcggtgctgctggtcggcattatggcaccg
ccgaacatgggtgacgattacgccaagcgcttcaacccgatctatccgaagttagcagaa
aaatacaacctgccgctttatccgttttttctggatggcgtggtgacggatgataagttg
aagctggaggacaagatgcatcccaatacgcagggtgtggcgatgatggtggagaaatct
ttgccggctgttgaaagcttcatcaagacaatcggtgcgcaaaaaaaataa

DBGET integrated database retrieval system