KEGG   Agrobacterium sp. H13-3: AGROH133_08948Help
Entry
AGROH133_08948    CDS       T01432                                 

Gene name
tesA
Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:agr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641924..2642574)
Genome map
AA seq 216 aa AA seqDB search
MRFKAALFHFIVIFAAAFSASAAVAQERTLQLVGLGDSLMAGYQLPPTDGYTAQLEAALK
AKGINVTVTNAGVSGDTSSGGLARAEWSVPDGTDGVILELGANDALRGIAPEQTEKNLDA
IISSFQKRNIAVLLVGIMAPPNMGDDYAKRFNPIYPKLAEKYNLPLYPFFLDGVVTDDKL
KLEDKMHPNTQGVAMMVEKSLPAVESFIKTIGAQKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaagctgccctgtttcacttcatcgtcattttcgccgccgccttttccgcc
tcggcggccgtggcgcaggagcggacattgcaattggttggcctgggcgacagtctcatg
gcgggttaccagttaccccccaccgatggctatacggcacagcttgaagctgcattaaag
gccaagggcatcaatgttaccgtcaccaatgccggtgtgtccggcgatacgtcctcaggc
ggtctggctcgggcggagtggtcggttcccgatggcacggacggggtcattctggaactc
ggcgccaatgatgcgttgcgcggtattgcgccggaacagacggaaaagaacctcgacgcc
atcatttccagctttcagaaacgcaacatagcggtgctgctggtcggcattatggcaccg
ccgaacatgggtgacgattacgccaagcgcttcaacccgatctatccgaagttagcagaa
aaatacaacctgccgctttatccgttttttctggatggcgtggtgacggatgataagttg
aagctggaggacaagatgcatcccaatacgcagggtgtggcgatgatggtggagaaatct
ttgccggctgttgaaagcttcatcaagacaatcggtgcgcaaaaaaaataa

DBGET integrated database retrieval system