KEGG   Agrobacterium sp. H13-3: AGROH133_09618Help
Entry
AGROH133_09618    CDS       T01432                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AGROH133_09618
  Lipid metabolism
   00561 Glycerolipid metabolism
    AGROH133_09618
   00600 Sphingolipid metabolism
    AGROH133_09618
Enzymes [BR:agr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AGROH133_09618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(165561..166934)
Genome map
AA seq 457 aa AA seqDB search
MARDPKITFIGAGSTVFMKNIIGDVLQRPALSGATIALMDINRERLEESAIVVNKLISTL
GAKAKAETFTDQKKALAGADFVVVAFQIGGYEPCTVTDFEVPRKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLAVCPNAIMLQYVNPMAINTWAIAEKYPTIRQVGLCHSVQGTA
MELAHDLDIPYEEIRYRSAGINHMAFFLEFEHRQPDGSYKNLYPDLVRGYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGREDLIEKFGIPLDEYPKRCIEQ
IERWKGQAAAYRSAEKIEVKQSKEYASSIINSVWTGEPSVIYGNQRNNGCITSLPSDCAA
EVPCLVDHNGVQPTFIGELPPQLTALMRTNINVQELTVRALMSENREHIFHAAMMDPHTA
AELDLDQIWSLVDDLLVAHRDWLPEWTQVEVKRARAV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcacgagatcccaagatcacatttatcggcgcaggttccacggtgttcatgaagaac
atcatcggcgacgtgctgcaacgtccggccctttcaggagcaacgatcgcgctgatggac
atcaaccgggaaaggctggaagaaagcgccatcgtcgtcaacaagctgatttcgacgctc
ggggcaaaggcgaaagccgagacttttacagaccagaaaaaggcgctcgccggtgccgat
ttcgtcgtcgtcgccttccagatcggcggatacgagccctgcacagtcaccgacttcgag
gtgccgcgcaaatatggcctgcgccagaccattgccgatacgcttggtgtcggcggcatc
atgcgaggcctgcgcaccgtgccgcatctgtggaagatttgcgaggatatgctcgccgtc
tgccccaatgcgatcatgctgcaatatgtcaacccgatggcgatcaacacctgggcgatt
gcggagaaatatccgaccatccggcaggtcggcctttgccattcggtgcagggcacggcc
atggaactcgcccatgacctcgatattccctatgaggaaatccgctatcgttcggccggc
atcaaccacatggcgtttttcctggaattcgagcaccgccagcctgatggcagctacaag
aacctctatcccgatctcgtgcgcggctatcgcgaaggccgtgcgccgaagcccggctgg
aacccgcgctgccccaacaaggtgcggtacgagatgctgacgcgtctcggctacttcgtc
accgaaagctccgagcattttgccgaatacacaccctatttcatcaaggaggggcgcgag
gatctgatcgagaaattcggtattccgctcgatgaatatcccaagcgctgcatcgagcag
atcgagcgttggaaggggcaggcggctgcctatcgctcagccgagaagatcgaggtcaag
caatccaaggaatatgcctcctccatcatcaactcggtctggaccggcgaaccgtctgtc
atctacggcaaccagcgcaacaatggctgcatcacctcgctgccatcagattgcgctgcg
gaagtgccctgccttgtcgatcataacggcgtgcaaccaaccttcatcggagaattgccg
ccgcagctgaccgcgctgatgcgcacaaacatcaatgtgcaggagctgacggtgcgggcg
ctgatgagcgaaaaccgcgagcatatcttccacgcggcgatgatggacccgcatacggca
gcggaactcgatctcgaccagatctggtcgctggtggatgatctgcttgtcgcgcaccgg
gactggttgccggaatggacgcaggtggaggtgaagcgcgctcgcgcggtgtaa

DBGET integrated database retrieval system