KEGG   Agrobacterium sp. H13-3: AGROH133_10197Help
Entry
AGROH133_10197    CDS       T01432                                 

Definition
signal transduction histidine kinase with CheB and CheR activity (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:agr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:agr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(420571..424983)
Genome map
AA seq 1470 aa AA seqDB search
MECASILTRVNMTERGADSNKVPSTFEVDTGPMSGSQEASPVRMFPIVGVGASSGGLNAF
RSLLKALPEKTGCAFLLVQHLDRSHESMLAELLASETNMVVTEAVNLALIEPEHVYVIPP
KFLMSVDEGRIYLSPRRELHEAPLPFDFLLGSMAKEFGPWAIAAVLSGTGSDGSSGVQQI
RDFKGLVLVQEPQDAQFGGMPESVISLGIGATVLPVEKMPAAIAKHIALLSRLRADHSMV
RRMPQLGRIIEILRVSTANDFSAYKHGTMQRRVEKRIAVLGIEIEEIDRYLEMLENSEEE
RQNLVRDLLINVTSFFRDGKVFDFLRDTIIPDILHAKAAHGAVRVWVAGCSTGEEAYSLA
ILFLELIQSMGLRLQFQMFASDADGEAVAIARDGHYSHEATKSLPTDLLEKYFVRDDNGY
TVTTQLRGAVVFTVQNVLSDPPFSRIDLISCRNLLIYLEADAQAKVLSLFRFALRENGIL
LVGKSETVGGMDDRFKLISETERVYRRIGPPVFGDLNFGVAPGGNVRIPSSLGKVTSASR
HSALADAVAQVLLGSYVPAAILVNRKYEYLYSIGPTARFLRIASGPASHDLFAMTPKAIH
NKIRSAIHRATRDQKPFVAKNAKLDSNGAHIEFSIHVEPLFSQGEELFLICFVEDAAQAN
RVVRSQKSSTTDASPITELEFELEETRAELQGAIRNLEIASEEQKQITAEALSLNEEYQS
TNEELVTSKEELQSLNEELTALNNQLHEALERQRAVSNDLQNVLYSTDVPTLFLDASLRI
RFFTPATRSVFKIISSDVGRPLSDLSGFDGDITLQVDAMATLQDGNTIDREIGGPDGRWY
VRRVKPYRGESETVDGVVITFIDMSAQKQVAESREAAKKSAERATEAKSQFLSAASHDLR
QPLQTLKLLQGLLEKSVGEGQARTFVQRMEETLSSMLGILNSVLDINQIEAGMVEPQIVS
FAIGDLLGRLFKEFYYPAQAAGLQLHVVPSSLAVRTDPRLFEQIVRNLLSNALKYTTSGK
ILVGCRRRGTKVRFEVWDTGIGIPENHIEDVFQEYLQLDAPAGTEDRGLGLGLSIVKRLS
ELLELRVVVQSRLHKGSAFMIEIDHAPAGEPLVPLPAPVDDHSNQAATLSRASVLIVEDE
NGMRDLLKMGLEQTGYVVAATSTAAEALAIVRGLQFTPDVILADYNLPTGGNGIAAIGDI
RQALRRNVPALILTGDISSKALRAFAQHEIPYLHKPAKLKDVVQVVETLVVRQTDERVVH
ISEPEYMRPMTGRLIEVIDDQQDIRDNLRALFEGEGWTVATYVSAEEYLADYQPDRSGCL
LVDAYLPGMVGMELLRLLKEKHHRFPVIVITGRSDVRMAINAMRYGAADFIEKPFSYQEI
YRSVQSALERSRDANEREERRETARATLATLTRKQRQILDRIVQGQANKVIAADLKLSQR
TVENHRASIMRRTKSASLPALLRLVLNAEE
NT seq 4413 nt NT seq  +upstreamnt  +downstreamnt
ttggaatgcgcgtcaattttaacgagagtgaatatgacggaacgcggcgcggatagtaac
aaggttccctctactttcgaggtagacaccggtccgatgtccgggtcacaggaagcaagt
cccgttaggatgttcccgattgtcggcgtcggagcttcatcgggtggactgaatgcgttc
agatccctgctcaaggcgttgcctgaaaaaaccggctgtgcgtttcttctcgttcagcat
cttgaccggtcgcatgaaagcatgctcgcagaacttctggcgagcgaaacgaatatggtc
gtgaccgaggctgtcaatcttgcattgatagagcccgagcacgtctacgtcattccacca
aaattcctgatgtcggttgacgaaggaaggatatatctgtcgccccggcgtgaactgcat
gaggcacctctgccgtttgattttctcttgggttctatggccaaagaattcgggccgtgg
gcgatagcagctgtcctgtccggcacggggtcagatggctcatccggcgtccagcagatc
agggatttcaagggacttgttctagtccaggagcctcaagacgcacagtttggcggcatg
cccgaaagtgttatttcgctgggcattggcgctacggttttaccggtcgaaaagatgcct
gcggccatcgccaaacatattgcgctgttgtcgcggcttcgagccgatcactcgatggtg
cgccgaatgccccagctgggccggattatcgagatattgagggtttccacagcgaatgat
ttttcggcctataaacatggaacgatgcagcgccgtgtcgaaaaacgcattgcggttctc
ggtatcgagatcgaggagattgaccgatatcttgagatgctcgaaaacagcgaagaagag
cggcaaaatctcgtcagggatcttctgatcaacgtcaccagcttcttccgcgacgggaag
gtgttcgactttctacgcgacaccattattccggatattctccacgcaaaagcggctcac
ggagcagtgcgggtctgggtcgctggatgcagcacgggggaagaagcatattctctggct
attctcttcctcgagctcattcagtccatgggccttcgtctccagtttcagatgtttgcc
tcggacgccgatggcgaggcggtcgcaattgccagagacggacactactcacatgaggcg
accaaatcgctgccgacggacttgctggaaaaatatttcgtaagggatgacaacggatac
accgtgacgacgcaactgcgtggggcggtggtattcaccgtgcagaatgtcctgagcgac
ccacccttctcaaggatcgatctgatctcatgccgcaacctgctgatttaccttgaggca
gacgcccaggccaaagttttatcgcttttcaggttcgccttgcgggagaacggcatttta
ctggtcggaaaatccgaaaccgttggcggaatggatgaccgtttcaagctgatttcggaa
accgaacgggtatatcggcgtatcgggccgccggttttcggtgatcttaatttcggcgtg
gctccgggtggaaatgtcagaattccctcttcgctgggaaaggtgacttcagcgtcgagg
cacagtgcgcttgccgacgcggttgcccaggttctgctgggtagctacgtgcccgccgcg
atcctcgtcaatcgaaagtatgaatatctttactccataggcccgacagcaaggttcctg
cggatcgcttcaggcccggcatcgcatgatctgttcgccatgacaccgaaggcgatccat
aataagatcaggtctgcgatccaccgtgcgacccgggatcagaagccattcgtagccaag
aatgcaaaactcgacagcaacggcgcgcatatcgagttcagcattcacgtcgaaccgctg
ttcagtcagggtgaagagctgttcctcatatgtttcgtggaagatgctgcgcaggccaac
agggttgtccgatcgcagaaatcatcgacgacagatgcgtcgcccattaccgagctggaa
ttcgaactggaggagacacgggcggaattgcagggcgccatacgcaatctggaaattgcc
agcgaagaacagaagcagatcaccgccgaagcactgtctctgaatgaagagtatcagtcg
acgaatgaggaactcgttacttcgaaagaggagctgcaatccctcaatgaagagctgaca
gccctcaacaatcaattgcacgaagcactggagcgtcagcgcgcagtttccaacgatctg
caaaacgtcttgtacagcaccgatgtcccgacgctctttctggatgccagtcttcgtata
aggttttttacaccagccacccggtcagtattcaagattatatcgtccgatgtcggccgc
cccctctcggaccttagcggctttgacggcgacattacgcttcaagtcgatgcgatggcg
accctccaggacggcaatacaatcgacagggagataggaggacctgacggccgctggtat
gtccgccgcgtcaaaccctatcgcggagagagcgaaaccgtcgacggggtcgttatcaca
ttcatcgatatgagcgcccagaaacaggttgcggaaagcagggaggctgcaaagaaatcc
gccgagcgggcgactgaggcaaagtcgcagttcctgtctgcggcaagccacgatctgcgt
cagccgctgcaaaccttgaagctgttgcaggggcttttggaaaagagcgtgggcgaaggc
caggcgcgcaccttcgttcagaggatggaggagacgctgtcgtcgatgttgggaatactc
aactccgttctcgacatcaaccagatcgaagcgggtatggtggaacctcagatcgtgagc
tttgcaataggcgatcttctgggaaggctcttcaaggaattttactatcccgctcaggcc
gccgggctgcaactccatgtcgtgccgtccagccttgccgttcgcaccgatccgcgtctg
ttcgagcagatcgttcgcaaccttctgtccaatgcgctgaaatatacgacgagcggcaaa
attctggtcggttgtcgccggcgcggtacgaaggttcgcttcgaagtgtgggacactggc
atcggcattcccgaaaaccatatcgaggatgtttttcaggaatacctccagctcgatgcg
cctgctggaacggaagaccgtggtttggggctgggattgtcgatcgtcaagcggctcagc
gagcttctcgaactaagggtagtggtgcagtcacgactgcataaaggttcggcattcatg
atcgagatcgatcacgcaccggccggtgagccgcttgtaccacttcctgcgccagtggat
gaccattcgaaccaagcggctaccctgtcgcgggcgtcggttctgatcgtcgaagacgaa
aacggcatgcgtgatttgctcaagatgggacttgagcagactggatatgtggtggctgcg
acctctacggctgccgaggcgctcgcgattgttcgaggattgcagttcacgcccgacgtc
attctcgcagactacaatctccctaccggggggaatggcatagctgcgataggagatatc
cggcaagcactccgccgaaatgttccggcgctcattctcacaggcgatatttcaagcaag
gccctgagggcttttgcacagcacgaaattccgtatctgcacaagccggcgaaactcaag
gacgtcgtgcaggtcgtcgagaccctggttgttcgccaaaccgacgagagggtagtgcac
ataagcgaacccgaatacatgaggccgatgacgggtcggctcatcgaagtcatcgacgac
cagcaggacatcagggacaatttgcgcgctcttttcgaaggagaaggctggacggttgca
acctatgtatcggcagaagagtatcttgcagattaccagccggacagatcaggttgtctg
cttgtcgatgcgtatctgccgggcatggtcggcatggagttgctgcgtttactgaaagaa
aaacatcatcggtttccggtgattgtgatcacgggtcgtagcgatgtccgtatggcaatc
aatgcgatgcgatatggagcggccgatttcatcgagaagccgttttcttaccaggagata
tatcggagcgtgcaatcggccctcgagcgatcgcgtgatgcaaacgagcgcgaagagcgg
cgtgaaacggctcgtgccacgctggcaacgcttactcgcaagcaacgccagatccttgac
cggattgttcaggggcaggccaacaaggttattgcagctgatttgaagcttagtcagcgc
actgtcgagaaccatcgcgcatcaatcatgcgccgaacgaaatccgcttcgttgccggcg
ctgttgcggcttgtcctgaatgccgaagaatag

DBGET integrated database retrieval system