KEGG   Agrobacterium sp. H13-3: AGROH133_11151Help
Entry
AGROH133_11151    CDS       T01432                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:agr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(808250..809305)
Genome map
AA seq 351 aa AA seqDB search
MRRGIFRLAGIFCVSLMALISSISIARAASVSPEAWSAYKSAFLDPGGRIIDTGNGNISH
SEGQGYGMWLAVLSENIADFELIWSFTRTELLVRDDGLSAWKWDPRTRPHVTDINNATDG
DILIAYALALAAAQWNRQDYAEASAAIASAVLKKTVVQRGGRTLLLPAASGFGEVDRGDG
PVVNPSYLIFEAFPVLNLVAPSPLWKALADDGVAQIGTFAFSDRKLPADWVSMKTKPQPA
SAFPPEFGYNAVRIPLYLARAKMGSPELLDRLKNGMTLESGAAGTFDLKSGAVKDVLSDP
GYRIIPALAACAGGGPAVPAELKGFQPTLYYPSTLHLLALSFLARNNGECR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgggatttttagacttgccggcattttctgcgtgtcgctgatggcgttgatc
tcaagcatctcgattgcccgcgccgcatctgtctcgcctgaggcctggtcggcttataaa
agtgcgtttctcgatcccggcgggcgcatcatcgataccggtaacggcaatatcagccat
agcgaaggccagggttacggcatgtggcttgccgttctttcagagaacattgccgacttc
gagctgatatggagttttacccgcacggaactcctggtgcgcgacgacggtctctcagcg
tggaaatgggatccgcgcaccagaccgcatgtgactgacatcaacaatgccacggatggc
gatattctgattgcctacgcgctggcgctggctgccgcgcagtggaaccggcaggactat
gccgaggcatcggcggccatcgcatcggccgtcctcaagaaaactgtcgttcagcgcggc
gggcgaacgctgcttttgcccgccgccagcggctttggcgaggttgaccggggcgacggc
ccggtggtcaatccttcctacctgattttcgaagcatttccggtcctcaatctcgtcgca
ccatcgccactctggaaggcgctcgccgacgacggcgtggcgcagatcggtacgtttgct
ttcagcgacaggaaactgccagccgactgggtgtcgatgaagacgaaaccgcaaccggca
tcggcgtttccgcccgagtttggttacaatgcagtgcggattccgctttatcttgcaagg
gcgaaaatgggctcgccggagctgcttgaccgcctgaaaaacggcatgacgctggaaagc
ggtgctgcgggaaccttcgatctcaagagcggcgcggtcaaggacgttctgtcggatccc
ggttatcgcatcattccggcgctcgcggcctgcgccggcggcggcccggctgtgcctgcc
gaactgaaaggctttcagccaacgctttattatccttctacattgcatcttctggcattg
tcgtttctggcaaggaataacggggagtgccgatga

DBGET integrated database retrieval system