KEGG   Agrobacterium sp. H13-3: AGROH133_12387Help
Entry
AGROH133_12387    CDS       T01432                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AGROH133_12387
Enzymes [BR:agr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AGROH133_12387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1366231..1367172)
Genome map
AA seq 313 aa AA seqDB search
MIEATLRESEDNPVPGNHTVGYFTGHGGKQLRYSIFRASRHIARGTVVLLHGRNECIEKY
FETVSDLTAMGFWVATFDTRGQGGSERLLKKPGAGHVRRFSDYKRDISLFLEQVVLPDTR
LPFFMIAHSTGALAALAAAPGLSNRIDRLALCSPFIELDSQQSVPSSVIRLVATALSLLG
LGKLQLGRDQRERDFDGNPLTSDARRFARNLALHRQFPELFIGAPTARWVYEALKTMGRV
TRQDHLTDITIPTLILAPMLDTITPYKAQEELSRNFRAAQLLPITGARHELLHERDVFRK
QALAAIDAFFAPE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagccacattacgcgagagcgaagacaacccggttcccggcaaccataccgtc
ggttatttcaccggccacggcggcaaacagcttcgatactcgatcttccgcgctagccga
cacattgcgcgcggaaccgtggttctgctgcatggtcgcaacgaatgtatcgagaaatat
ttcgagaccgtcagcgatctgacggccatgggattctgggtcgcgaccttcgatacgcgt
gggcagggcggttccgaacggctgctgaagaagccaggcgccgggcatgtacgacgtttt
tccgactacaagcgcgacataagtttgtttctcgaacaggtggtgctgccggatacccgg
ctgccattcttcatgatcgcgcattcaaccggcgcacttgcagcactggccgcagcaccc
ggcctgtcgaacaggatcgaccgtctggcgctttgttcgccctttatcgagctggacagc
cagcaatccgttccttcgtccgtcatccggctggtcgcgaccgctttaagcctgttgggt
cttggaaagcttcagctcggcagggatcagcgcgaacgggatttcgatggcaacccgctg
acctctgacgcccgacgttttgccagaaatcttgcgctgcatcggcaatttccggaactc
ttcatcggcgcaccgacagcgcgatgggtttatgaagcgctgaaaacaatgggtcgggtg
acccgtcaggaccatctgacggacataaccattcccaccctcattcttgcgccgatgctg
gatacgatcacgccctataaggcgcaggaggaactctcgcgcaacttccgcgcggcgcag
cttcttcccataaccggtgctcgccatgaattgctgcatgagcgcgacgttttccgcaaa
caggcgctggcggccatcgacgcctttttcgcgccggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system