KEGG   Agrobacterium sp. H13-3: AGROH133_12401Help
Entry
AGROH133_12401    CDS       T01432                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AGROH133_12401
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AGROH133_12401
Exosome [BR:agr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGROH133_12401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1370104..1371603)
Genome map
AA seq 499 aa AA seqDB search
MGGYILAIDQGTTSTRSMVFDRDMRVIGVGQREFPQHFPASGWVEHDAEDIWKSVLETIR
LALADAGISASDIEAIGITNQRETTVLWDRNTGEAVHRAVVWQDRRAAPICEDLKRRGLE
PLFSKKTGLLLDPYFSGTKLKWLLDSVSGLREKAVKGEICFGTVDSFLIYRLTGGRRHVT
DATNASRTLIYNIEDNAWDDELLSILDIPSAMLPEVLDCAADFGVTDKALLGAEIPILGV
AGDQQAAVIGNACFEPGMMKSTYGTGCFALLNTGTDRVASTNRLLTTIAYRLDGVTTYAL
EGSIFIAGAAVQWLRDELGFISVASEVSALAEKADPKQRVYLVPAFTGLGAPYWDAEARG
AIFGLTRGTGPAEFARAALESVAYQTFDLLDAMRNDWAGDNGKTVLRVDGGMVASDWTMQ
RLADILAAPVDRPVFLETTILGAAWLAASRAGIWPDREAFAAHWKRDRRFLPDMDETERK
SAIAGWRDSVGRCLSKRED
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggcggttatattctggcgatcgatcaggggacgacatcgacaaggtcgatggtcttt
gatcgcgacatgcgggtcatcggtgtcggccagcgagaatttccgcagcatttcccggcc
tctggctgggtcgaacacgatgccgaggatatctggaaaagcgtgcttgaaacaatccgg
ctggcgcttgccgatgccggtatctccgcttccgatatcgaggcgatcggcatcaccaac
cagcgcgaaacgaccgtgctgtgggaccgtaatacgggcgaggccgtgcatcgggccgtt
gtctggcaggatcgccgtgctgcaccaatttgcgaggatctgaaacgaagggggctggag
ccgctcttttcgaaaaagaccggtctgctgctcgacccctacttttccggcacgaagctg
aaatggcttctcgacagcgtcagcggccttcgcgaaaaagccgtgaagggcgaaatctgc
ttcggcacggtcgacagtttcctgatctatcgcctcaccggcggtcgccgccatgtgacc
gacgccaccaatgcctcgcgaacgctgatctacaatatcgaggacaatgcctgggatgac
gaattgctgtccatcctcgacattcccagcgccatgctgccggaggtgcttgattgcgct
gccgatttcggcgtaacggacaaggcgcttctgggtgcggaaattccgatcctcggcgtc
gccggtgatcagcaggctgccgttatcggtaacgcctgcttcgaacccggcatgatgaaa
tcgacctatggcaccggctgctttgcgcttctcaataccggcaccgaccgggtcgcctcg
acaaaccggttgctgacgaccattgcctatcgcctcgatggcgtgacgacctatgcgctc
gaaggctcgatcttcattgccggcgccgccgtgcaatggctgcgtgacgagctcggtttc
atatcggtcgcgtctgaagtcagcgcgcttgccgaaaaggctgatcccaagcagcgggtt
tacctcgtgccggccttcaccggccttggcgcgccctattgggatgccgaagcgcggggc
gcgattttcggcctgacgcgtggcaccggccctgcggagttcgcccgcgcggcactcgaa
agcgtcgcctatcagactttcgatcttctggacgccatgcgcaacgactgggcgggcgac
aatggcaagacggtgctccgggtcgatggcggcatggttgcctcggattggaccatgcag
cggctggcggacattctcgctgcaccggtcgaccggccggtattcctggaaaccaccatt
ctcggtgcggcatggctcgcagcatcgcgcgccggcatctggccggaccgggaggccttt
gcggcccattggaaacgggatcgccgttttctgccagatatggatgagactgagcgtaag
agcgccatcgcggggtggcgtgatagtgttggccgctgcctctcgaaacgggaagattga

DBGET integrated database retrieval system